Molecule Details
| General Information of the Molecule | ||||
|---|---|---|---|---|
| Name |
Bcl-2-binding component 3 (BBC3)
|
|||
| Synonyms |
JFY-1; p53 up-regulated modulator of apoptosis
|
|||
| Gene Name |
BBC3
|
|||
| Gene ID | ||||
| Sequence |
MKFGMGSAQACPCQVPRAASTTWVPCQICGPRERHGPRTPGGQLPGARRGPGPRRPAPLP
ARPPGALGSVLRPLRARPGCRPRRPHPAARCLPLRPHRPTRRHRRPGGFPLAWGSPQPAP RPAPGRSSALALAGGAAPGVARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAADGG RPQRTVRAAETRGAAAAPPLTLEGPVQSHHGTPALTQGPQSPRDGAQLGACTRPVDVRDS GGRPLPPPDTLASAGDFLCTM Click to Show/Hide
|
|||
| Function |
Does not affect cell growth.
Click to Show/Hide
|
|||
| Uniprot ID | ||||
| KEGG ID | ||||
| TTD ID | ||||
| A List of Drug Combination(s) Able to Regulate This Molecule | ||||
|---|---|---|---|---|
| Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
| Up-regulation | Click to Show/Hide | |||
| Drug Combination 1 Up-regulating the Expression of This Molecule | [1] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Triptolide NP Info | + | Venetoclax Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 2 Up-regulating the Expression of This Molecule | [2] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Carnosic acid NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 3 Up-regulating the Expression of This Molecule | [3] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Apigenin NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 4 Up-regulating the Expression of This Molecule | [4] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Arsenic trioxide NP Info | + | Dasatinib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 5 Up-regulating the Expression of This Molecule | [5] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Wogonin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 6 Up-regulating the Expression of This Molecule | [6] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Curcumin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 7 Up-regulating the Expression of This Molecule | [7] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Wogonin NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 8 Up-regulating the Expression of This Molecule | [8] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Resveratrol NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 9 Up-regulating the Expression of This Molecule | [9] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Capsaicin NP Info | + | 3,3'-diindolylmethane Drug Info | |
| Structure |
|
+ |
|
|