Molecule Details
| General Information of the Molecule | ||||
|---|---|---|---|---|
| Name |
Beta-catenin (CTNNB1)
|
|||
| Synonyms |
Wnt/beta-catenin signaling pathway; PRO2286; OK/SW-cl.35; Catenin beta-1; CTNNB
|
|||
| Gene Name |
CTNNB1
|
|||
| Gene ID | ||||
| Sequence |
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTS
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD L Click to Show/Hide
|
|||
| Function |
In the absence of Wnt, forms a complex with AXIN1, AXIN2, APC, CSNK1A1 and GSK3B that promotes phosphorylation on N-terminal Ser and Thr residues and ubiquitination of CTNNB1 via BTRC and its subsequent degradation by the proteasome. In the presence of Wnt ligand, CTNNB1 is not ubiquitinated and accumulates in the nucleus, where it acts as a coactivator for transcription factors of the TCF/LEF family, leading to activate Wnt responsive genes. Involved in the regulation of cell adhesion, as component of an E-cadherin:catenin adhesion complex. Acts as a negative regulator of centrosome cohesion. Involved in the CDK2/PTPN6/CTNNB1/CEACAM1 pathway of insulin internalization. Blocks anoikis of malignant kidney and intestinal epithelial cells and promotes their anchorage-independent growth by down-regulating DAPK2. Disrupts PML function and PML-NB formation by inhibiting RANBP2-mediated sumoylation of PML. Promotes neurogenesis by maintaining sympathetic neuroblasts within the cell cycle. Key downstream component of the canonical Wnt signaling pathway.
Click to Show/Hide
|
|||
| Uniprot ID | ||||
| Pfam | ||||
| KEGG ID | ||||
| TTD ID | ||||
| A List of Drug Combination(s) Able to Regulate This Molecule | ||||
|---|---|---|---|---|
| Activity Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
| Down-regulation | Click to Show/Hide | |||
| Drug Combination 1 Down-regulating the Activity of This Molecule | [1] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Periplocin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
| Down-regulation | Click to Show/Hide | |||
| Drug Combination 1 Down-regulating the Expression of This Molecule | ||||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Resveratrol NP Info | + | Doxorubicin Drug Info | |
| Drug Combination 2 Down-regulating the Expression of This Molecule | [2] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Resveratrol NP Info | + | Doxorubicin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 3 Down-regulating the Expression of This Molecule | [3] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Curcumin NP Info | + | Mitomycin C Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 4 Down-regulating the Expression of This Molecule | [4] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Sulforaphane NP Info | + | Temozolomide Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 5 Down-regulating the Expression of This Molecule | [5] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Ursolic acid NP Info | + | Capecitabine Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 6 Down-regulating the Expression of This Molecule | [6] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Evodiamine NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 7 Down-regulating the Expression of This Molecule | [7] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Thymoquinone NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 8 Down-regulating the Expression of This Molecule | [8] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Esculetin NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 9 Down-regulating the Expression of This Molecule | [9] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Artemisinin NP Info | + | Oxaliplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 10 Down-regulating the Expression of This Molecule | [10] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Sulforaphane NP Info | + | Imatinib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 11 Down-regulating the Expression of This Molecule | [11] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Piperine NP Info | + | Celecoxib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 12 Down-regulating the Expression of This Molecule | [12] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Tetrandrine NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 13 Down-regulating the Expression of This Molecule | [13] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Cardamonin NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Up-regulation | Click to Show/Hide | |||
| Drug Combination 1 Up-regulating the Expression of This Molecule | [14] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Camptothecin NP Info | + | Doxorubicin Drug Info | |
| Structure |
|
+ |
|
|
| Phosphorylation Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
| Down-regulation | Click to Show/Hide | |||
| Drug Combination 1 Down-regulating the Phosphorylation of This Molecule | [1] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Periplocin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Natural Product(s) of This Target | ||||
|---|---|---|---|---|
| 1 | Cardamonin | NP Info | Investigative | Alpinia zerumbet |
| Drug(s) of This Target | ||||
|---|---|---|---|---|
| 1 | Endostar | Drug Info | Approved | Solid tumour/cancer |