Skip to main content
  •   Home
  •   Download
  •   Manual
  •   Contact

Molecule Details

General Information of the Molecule
Name
Interferon-gamma (IFNG)
Synonyms
Interferon gamma; Immune interferon; IFN-gamma
Gene Name
IFNG
Gene ID
3458
Sequence
MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWK
EESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTN
YSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
    Click to Show/Hide
Function
Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
    Click to Show/Hide
Uniprot ID
IFNG_HUMAN
Pfam
PF00714
KEGG ID
hsa3458
TTD ID
T77664
A List of Drug Combination(s) Able to Regulate This Molecule
          Expression Regulation     Click to Show/Hide the Drug Combination Regulating This Molecule
                 Down-regulation     Click to Show/Hide
                    Drug Combination 1 Down-regulating the Expression of This Molecule [1]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Sesquiterpene lactone   NP Info  + Benznidazole   Drug Info 
                    Structure +
                    Drug Combination 2 Down-regulating the Expression of This Molecule [2]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Acteoside   NP Info  + Dextran sulfate sodium   Drug Info 
                    Structure +
                 Up-regulation     Click to Show/Hide
                    Drug Combination 1 Up-regulating the Expression of This Molecule [3]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Bisdemethoxycurcumin   NP Info  + Alpha PD-L1 antibody   Drug Info 
                    Structure +
                    Drug Combination 2 Up-regulating the Expression of This Molecule [4]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Lycopene   NP Info  + Anti-PD-1 antibody   Drug Info 
                    Structure +
                    Drug Combination 3 Up-regulating the Expression of This Molecule [5]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + Recombinant vaccinia Neu vaccine   Drug Info 
                    Structure +
                    Drug Combination 4 Up-regulating the Expression of This Molecule [6]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + Anti-PD-1 antibody   Drug Info 
                    Structure +
                    Drug Combination 5 Up-regulating the Expression of This Molecule [7]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Elemene   NP Info  + DC/Dribble vaccine   Drug Info 
                    Structure +
                    Drug Combination 6 Up-regulating the Expression of This Molecule [8]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Carnosic acid   NP Info  + Cisplatin   Drug Info 
                    Structure +
References
Reference 1 Sesquiterpene lactone potentiates the immunomodulatory, antiparasitic and cardioprotective effects on anti-Trypanosoma cruzi specific chemotherapy. Int Immunopharmacol. 2019 Dec;77:105961.
Reference 2 In vivo treatment with the herbal phenylethanoid acteoside ameliorates intestinal inflammation in dextran sulphate sodium-induced colitis. Clin Exp Immunol. 2007 May;148(2):373-81.
Reference 3 Bisdemethoxycurcumin in combination with Alpha-PD-L1 antibody boosts immune response against bladder cancer. Onco Targets Ther. 2017 May 22;10:2675-2683.
Reference 4 Lycopene improves the efficiency of anti-PD-1 therapy via activating IFN signaling of lung cancer cells. Cancer Cell Int. 2019 Mar 21;19:68.
Reference 5 Curcumin Enhances the Antitumoral Effect Induced by the Recombinant Vaccinia Neu Vaccine (rV- neu T) in Mice with Transplanted Salivary Gland Carcinoma Cells. Nutrients. 2020 May 14;12(5):1417.
Reference 6 Synergistic efficacy of curcumin and anti-programmed cell death-1 in hepatocellular carcinoma. Life Sci. 2021 Mar 19;279:119359.
Reference 7 [Treatment of hepatic cancer in mice by beta-elemene combined DC/Dribble vaccine: an immune mechanism research]. Zhongguo Zhong Xi Yi Jie He Za Zhi. 2013 Feb;33(2):214-9.
Reference 8 Carnosic acid enhances the anti-lung cancer effect of cisplatin by inhibiting myeloid-derived suppressor cells. Chin J Nat Med. 2018 Dec;16(12):907-915.
Cite NPCDR
Visitor Map
Correspondence

X. N. Sun, Y. T. Zhang, Y. Zhou, X. C. Lian, L. L. Yan, T. Pan, T. Jin, H. Xie, Z. M. Liang, W. Q. Qiu, J. X. Wang, Z. R. Li, F. Zhu*, X. B. Sui*. NPCDR: natural product-based drug combination and its disease-specific molecular regulation. Nucleic Acids Research. 50(D1): 1324-1333 (2020). PMID: 34664659

Prof. Feng ZHU  (zhufeng@zju.edu.cn)

College of Pharmaceutical Sciences, Zhejiang University, Hangzhou, China


Prof. Xinbing SUI  (hzzju@hznu.edu.cn)

School of Pharmacy and Department of Medical Oncology, the Affiliated Hospital of Hangzhou Normal University, Hangzhou Normal University, Hangzhou, China