Molecule Details
General Information of the Molecule | ||||
---|---|---|---|---|
Name |
Interferon-gamma (IFNG)
|
|||
Synonyms |
Interferon gamma; Immune interferon; IFN-gamma
|
|||
Gene Name |
IFNG
|
|||
Gene ID | ||||
Sequence |
MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWK
EESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTN YSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ Click to Show/Hide
|
|||
Function |
Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
Click to Show/Hide
|
|||
Uniprot ID | ||||
Pfam | ||||
KEGG ID | ||||
TTD ID |
A List of Drug Combination(s) Able to Regulate This Molecule | ||||
---|---|---|---|---|
Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Down-regulation | Click to Show/Hide | |||
Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Sesquiterpene lactone NP Info | + | Benznidazole Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 2 Down-regulating the Expression of This Molecule | [2] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Acteoside NP Info | + | Dextran sulfate sodium Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Up-regulation | Click to Show/Hide | |||
Drug Combination 1 Up-regulating the Expression of This Molecule | [3] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Bisdemethoxycurcumin NP Info | + | Alpha PD-L1 antibody Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 2 Up-regulating the Expression of This Molecule | [4] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Lycopene NP Info | + | Anti-PD-1 antibody Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 3 Up-regulating the Expression of This Molecule | [5] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Curcumin NP Info | + | Recombinant vaccinia Neu vaccine Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 4 Up-regulating the Expression of This Molecule | [6] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Curcumin NP Info | + | Anti-PD-1 antibody Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 5 Up-regulating the Expression of This Molecule | [7] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Elemene NP Info | + | DC/Dribble vaccine Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 6 Up-regulating the Expression of This Molecule | [8] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Carnosic acid NP Info | + | Cisplatin Drug Info | |
Structure |
![]() |
+ |
![]() |