Molecule Details
| General Information of the Molecule | ||||
|---|---|---|---|---|
| Name |
Apoptosis mediating surface antigen FAS (FAS)
|
|||
| Synonyms |
Tumor necrosis factor receptor superfamily member 6; TNFRSF6; FASLG receptor; FAS1; CD95; Apoptosis-mediating surface antigen FAS; Apo-1 antigen; APT1
|
|||
| Gene Name |
FAS
|
|||
| Gene ID | ||||
| Sequence |
MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCH
KPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCT RTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLL LLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVM TLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKK ANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV Click to Show/Hide
|
|||
| Function |
Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. The secreted isoforms 2 to 6 block apoptosis (in vitro).
Click to Show/Hide
|
|||
| Uniprot ID | ||||
| Pfam | ||||
| KEGG ID | ||||
| TTD ID | ||||
| A List of Drug Combination(s) Able to Regulate This Molecule | ||||
|---|---|---|---|---|
| Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
| Down-regulation | Click to Show/Hide | |||
| Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Orientin NP Info | + | BS21 Drug Info | |
| Structure |
|
+ |
|
|
| Up-regulation | Click to Show/Hide | |||
| Drug Combination 1 Up-regulating the Expression of This Molecule | [2] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Lycopene NP Info | + | Eicosapentaenoic acid Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 2 Up-regulating the Expression of This Molecule | [3] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Gambogic acid NP Info | + | Doxorubicin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 3 Up-regulating the Expression of This Molecule | [4] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Gambogic acid NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 4 Up-regulating the Expression of This Molecule | [5] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Gossypol NP Info | + | Zoledronic Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 5 Up-regulating the Expression of This Molecule | [6] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Shikonin NP Info | + | 4-hydroxy-tamoxifen Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 6 Up-regulating the Expression of This Molecule | [7] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Epigallocatechin gallate NP Info | + | Interferon alpha-2b Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 7 Up-regulating the Expression of This Molecule | [8] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Polysaccharide NP Info | + | Cyclophosphamide Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 8 Up-regulating the Expression of This Molecule | [9] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Capsaicin NP Info | + | 3,3'-diindolylmethane Drug Info | |
| Structure |
|
+ |
|
|
| Natural Product(s) of This Target | ||||
|---|---|---|---|---|
| 1 | Ginsenoside Rh2 | NP Info | Investigative | Panax ginseng |
| 2 | Nobiletin | NP Info | Investigative | Ageratum conyzoides |