Molecule Details
General Information of the Molecule | ||||
---|---|---|---|---|
Name |
Gamma-histone H2AX (H2AFX)
|
|||
Synonyms |
Phosphorylation of H2AX; Histone H2AX; Histone H2A.x; H2a/x; H2AX
|
|||
Gene Name |
H2AX
|
|||
Gene ID | ||||
Sequence |
MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TSATVGPKAPSGGKKATQASQEY Click to Show/Hide
|
|||
Function |
Variant histone H2A which replaces conventional H2A in a subset of nucleosomes. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Required for checkpoint-mediated arrest of cell cycle progression in response to low doses of ionizing radiation and for efficient repair of DNA double strand breaks (DSBs) specifically when modified by C-terminal phosphorylation.
Click to Show/Hide
|
|||
Uniprot ID | ||||
Pfam | ||||
KEGG ID | ||||
TTD ID |
A List of Drug Combination(s) Able to Regulate This Molecule | ||||
---|---|---|---|---|
Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Down-regulation | Click to Show/Hide | |||
Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Elemene NP Info | + | Temozolomide Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Up-regulation | Click to Show/Hide | |||
Drug Combination 1 Up-regulating the Expression of This Molecule | [2] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Triptolide NP Info | + | Gemcitabine Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 2 Up-regulating the Expression of This Molecule | [3] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Triptolide NP Info | + | Cytarabine Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 3 Up-regulating the Expression of This Molecule | [4] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Curcumin NP Info | + | ABT-888 Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 4 Up-regulating the Expression of This Molecule | [5] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Paclitaxel NP Info | + | Alpelisib Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 5 Up-regulating the Expression of This Molecule | [3] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Triptolide NP Info | + | Doxorubicin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Phosphorylation Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Up-regulation | Click to Show/Hide | |||
Drug Combination 1 Up-regulating the Phosphorylation of This Molecule | [6] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Gingerol NP Info | + | Doxorubicin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 2 Up-regulating the Phosphorylation of This Molecule | [7] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Thymoquinone NP Info | + | Cisplatin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 3 Up-regulating the Phosphorylation of This Molecule | [8] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Cidofovir NP Info | + | Cetuximab Drug Info | |
Structure |
![]() |
+ |
![]() |