Molecule Details
General Information of the Molecule | ||||
---|---|---|---|---|
Name |
GA-binding protein alpha (GABPA)
|
|||
Synonyms |
GABP subunit alpha; Nuclear respiratory factor 2 subunit alpha; Transcription factor E4TF1-60; GA-binding protein alpha chain
|
|||
Gene Name |
GABPA
|
|||
Gene ID | ||||
Sequence |
MTKREAEELIEIEIDGTEKAECTEESIVEQTYAPAECVSQAIDINEPIGNLKKLLEPRLQ
CSLDAHEICLQDIQLDPERSLFDQGVKTDGTVQLSVQVISYQGIEPKLNILEIVKPADTV EVVIDPDAHHAESEAHLVEEAQVITLDGTKHITTISDETSEQVTRWAAALEGYRKEQERL GIPYDPIQWSTDQVLHWVVWVMKEFSMTDIDLTTLNISGRELCSLNQEDFFQRVPRGEIL WSHLELLRKYVLASQEQQMNEIVTIDQPVQIIPASVQSATPTTIKVINSSAKAAKVQRAP RISGEDRSSPGNRTGNNGQIQLWQFLLELLTDKDARDCISWVGDEGEFKLNQPELVAQKW GQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIGYSAAELNRLVTE CEQKKLAKMQLHGIAQPVTAVALATASLQTEKDN Click to Show/Hide
|
|||
Function |
Transcription factor capable of interacting with purine rich repeats (GA repeats). Necessary for the expression of the Adenovirus E4 gene.
Click to Show/Hide
|
|||
Uniprot ID | ||||
Pfam | ||||
KEGG ID |
A List of Drug Combination(s) Able to Regulate This Molecule | ||||
---|---|---|---|---|
Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Down-regulation | Click to Show/Hide | |||
Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Resveratrol NP Info | + | Doxorubicin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 2 Down-regulating the Expression of This Molecule | [2] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Alpinumisoflavone NP Info | + | X-ray irradiation Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 3 Down-regulating the Expression of This Molecule | [3] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Luteolin NP Info | + | Oxaliplatin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 4 Down-regulating the Expression of This Molecule | [4] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Cryptotanshinone NP Info | + | Gefitinib Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 5 Down-regulating the Expression of This Molecule | [5] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Osthole NP Info | + | Cisplatin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 6 Down-regulating the Expression of This Molecule | [6] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Wogonin NP Info | + | Cisplatin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 7 Down-regulating the Expression of This Molecule | [7] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Resveratrol NP Info | + | Clofarabine Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 8 Down-regulating the Expression of This Molecule | [8] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Cyanidin-3-O-glucoside chloride NP Info | + | Cisplatin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 9 Down-regulating the Expression of This Molecule | [9] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Ursolic acid NP Info | + | Cisplatin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Up-regulation | Click to Show/Hide | |||
Drug Combination 1 Up-regulating the Expression of This Molecule | [10] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Arsenic trioxide NP Info | + | Bacillus Calmette-Guerin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 2 Up-regulating the Expression of This Molecule | [11] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Taxifolin NP Info | + | Dapagliflozin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 3 Up-regulating the Expression of This Molecule | [12] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Daphnetin NP Info | + | Cisplatin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 4 Up-regulating the Expression of This Molecule | [13] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Schisandrol B NP Info | + | Cyclosporin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 5 Up-regulating the Expression of This Molecule | [14] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Curcumin NP Info | + | Thioridazine Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 6 Up-regulating the Expression of This Molecule | [15] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Apocynin NP Info | + | Cyclophosphamide Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 7 Up-regulating the Expression of This Molecule | [16] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Apocynin NP Info | + | Edaravone Drug Info | |
Structure |
![]() |
+ |
![]() |