Molecule Details
General Information of the Molecule | ||||
---|---|---|---|---|
Name |
G1/S-specific cyclin-D1 (CCND1)
|
|||
Synonyms |
PRAD1 oncogene; PRAD1; Cyclin D1; BCL1; BCL-1 oncogene; BCL-1; B-cell lymphoma 1 protein
|
|||
Gene Name |
CCND1
|
|||
Gene ID | ||||
Sequence |
MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRK HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCD PDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI Click to Show/Hide
|
|||
Function |
Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also substrate for SMAD3, phosphorylating SMAD3 in a cell-cycle-dependent manner and repressing its transcriptional activity. Component of the ternary complex, cyclin D1/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex. Exhibits transcriptional corepressor activity with INSM1 on the NEUROD1 and INS promoters in a cell cycle-independent manner. Regulatory component of the cyclin D1-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition.
Click to Show/Hide
|
|||
Uniprot ID | ||||
Pfam | ||||
KEGG ID | ||||
TTD ID |
A List of Drug Combination(s) Able to Regulate This Molecule | ||||
---|---|---|---|---|
Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Down-regulation | Click to Show/Hide | |||
Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Curcumin NP Info | + | 5-fluorouracil Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 2 Down-regulating the Expression of This Molecule | [2] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Silibinin NP Info | + | Indole-3-carbinol Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 3 Down-regulating the Expression of This Molecule | [3] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Gamma tocotrienol NP Info | + | GW9662 Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 4 Down-regulating the Expression of This Molecule | [4] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Elemene NP Info | + | Etoposide Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 5 Down-regulating the Expression of This Molecule | [5] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | 6-shogaol NP Info | + | Gemcitabine Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 6 Down-regulating the Expression of This Molecule | [6] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Triptolide NP Info | + | AMD3100 Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 7 Down-regulating the Expression of This Molecule | [7] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Shikonin NP Info | + | Gefitinib Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 8 Down-regulating the Expression of This Molecule | [8] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Curcumin NP Info | + | Mitomycin C Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 9 Down-regulating the Expression of This Molecule | [9] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Methylselenocysteine NP Info | + | Tamoxifen Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 10 Down-regulating the Expression of This Molecule | [10] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Arctigenin NP Info | + | Cisplatin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 11 Down-regulating the Expression of This Molecule | [11] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Ursolic acid NP Info | + | Gemcitabine Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 12 Down-regulating the Expression of This Molecule | [12] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Curcumin NP Info | + | Capecitabine Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 13 Down-regulating the Expression of This Molecule | [13] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Gossypol NP Info | + | 5-fluorouracil Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 14 Down-regulating the Expression of This Molecule | [14] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Arsenic trioxide NP Info | + | Itraconazole Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 15 Down-regulating the Expression of This Molecule | [15] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Arsenic trioxide NP Info | + | Bortezomib Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 16 Down-regulating the Expression of This Molecule | [16] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Hesperetin NP Info | + | Cisplatin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 17 Down-regulating the Expression of This Molecule | [17] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Vitamin D NP Info | + | S-farnesylthiosalicylic acid Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 18 Down-regulating the Expression of This Molecule | [18] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Betulinic Acid NP Info | + | Sorafenib Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 19 Down-regulating the Expression of This Molecule | [19] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Elemene NP Info | + | Cisplatin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 20 Down-regulating the Expression of This Molecule | [20] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Curcumin NP Info | + | Cisplatin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 21 Down-regulating the Expression of This Molecule | [21] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Curcumin NP Info | + | Gemcitabine Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 22 Down-regulating the Expression of This Molecule | [22] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Resveratrol NP Info | + | Sorafenib Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 23 Down-regulating the Expression of This Molecule | [23] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Resveratrol NP Info | + | Gemcitabine Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 24 Down-regulating the Expression of This Molecule | [24] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Thymoquinone NP Info | + | Cisplatin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 25 Down-regulating the Expression of This Molecule | [25] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Flavopiridol NP Info | + | Trastuzumab Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 26 Down-regulating the Expression of This Molecule | [26] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Apigenin NP Info | + | Cetuximab Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 27 Down-regulating the Expression of This Molecule | [27] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Honokiol NP Info | + | Rosiglitazone Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 28 Down-regulating the Expression of This Molecule | [28] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Noscapine NP Info | + | Gemcitabine Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 29 Down-regulating the Expression of This Molecule | [29] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Shikonin NP Info | + | Gemcitabine Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 30 Down-regulating the Expression of This Molecule | [30] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Curcumin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 31 Down-regulating the Expression of This Molecule | [31] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Ursolic acid NP Info | + | Capecitabine Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 32 Down-regulating the Expression of This Molecule | [32] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Piperine NP Info | + | Temozolomide Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 33 Down-regulating the Expression of This Molecule | [33] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Epigallocatechin gallate NP Info | + | Ponatinib Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 34 Down-regulating the Expression of This Molecule | [34] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Pterostilbene NP Info | + | Sorafenib Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 35 Down-regulating the Expression of This Molecule | [35] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Resveratrol NP Info | + | Clofarabine Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 36 Down-regulating the Expression of This Molecule | [36] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Esculetin NP Info | + | 5-fluorouracil Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 37 Down-regulating the Expression of This Molecule | [37] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Noscapine NP Info | + | Cisplatin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 38 Down-regulating the Expression of This Molecule | [38] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Capsaicin NP Info | + | Cisplatin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 39 Down-regulating the Expression of This Molecule | [39] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Curcumin NP Info | + | Tamoxifen Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 40 Down-regulating the Expression of This Molecule | [40] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Arsenic trioxide NP Info | + | Sorafenib Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 41 Down-regulating the Expression of This Molecule | [41] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Gingerol NP Info | + | Cisplatin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 42 Down-regulating the Expression of This Molecule | [42] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Triptolide NP Info | + | Temozolomide Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 43 Down-regulating the Expression of This Molecule | [43] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Curcumin NP Info | + | Bacillus Calmette-Guerin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 44 Down-regulating the Expression of This Molecule | [44] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Ginsenoside Rg3 NP Info | + | Oxaliplatin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 45 Down-regulating the Expression of This Molecule | [45] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Arsenic trioxide NP Info | + | BIBR1532 Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 46 Down-regulating the Expression of This Molecule | [46] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Ursolic acid NP Info | + | Cisplatin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Up-regulation | Click to Show/Hide | |||
Drug Combination 1 Up-regulating the Expression of This Molecule | [47] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Triptolide NP Info | + | Cisplatin Drug Info | |
Structure |
![]() |
+ |
![]() |
Drug(s) of This Target | ||||
---|---|---|---|---|
1 | ABT-263 | Drug Info | Phase 2 | Chronic lymphocytic leukaemia |