Molecule Details
General Information of the Molecule | ||||
---|---|---|---|---|
Name |
TRAIL receptor 2 (TRAIL-R2)
|
|||
Synonyms |
ZTNFR9; UNQ160/PRO186; Tumor necrosis factor receptor superfamily member 10B; TRICK2; TRAILR2; TNF-related apoptosis-inducing ligand receptor 2; KILLER; Death receptor 5; DR5; CD262
|
|||
Gene Name |
TNFRSF10B
|
|||
Gene ID | ||||
Sequence |
MEQRGQNAPAASGARKRHGPGPREARGARPGPRVPKTLVLVVAAVLLLVSAESALITQQD
LAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCD SGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVH KESGTKHSGEVPAVEETVTSSPGTPASPCSLSGIIIGVTVAAVVLIVAVFVCKSLLWKKV LPYLKGICSGGGGDPERVDRSSQRPGAEDNVLNEIVSILQPTQVPEQEMEVQEPAEPTGV NMLSPGESEHLLEPAEAERSQRRRLLVPANEGDPTETLRQCFDDFADLVPFDSWEPLMRK LGLMDNEIKVAKAEAAGHRDTLYTMLIKWVNKTGRDASVHTLLDALETLGERLAKQKIED HLLSSGKFMYLEGNADSAMS Click to Show/Hide
|
|||
Function |
Receptor for the cytotoxic ligand TNFSF10/TRAIL. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappa-B. Essential for ER stress-induced apoptosis.
Click to Show/Hide
|
|||
Uniprot ID | ||||
Pfam | ||||
KEGG ID | ||||
TTD ID |
A List of Drug Combination(s) Able to Regulate This Molecule | ||||
---|---|---|---|---|
Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Down-regulation | Click to Show/Hide | |||
Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Epigallocatechin gallate NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 2 Down-regulating the Expression of This Molecule | [2] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Arsenic trioxide NP Info | + | Buthionine sulfoximine Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 3 Down-regulating the Expression of This Molecule | [3] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Cyclopamine NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Up-regulation | Click to Show/Hide | |||
Drug Combination 1 Up-regulating the Expression of This Molecule | [4] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Capsaicin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 2 Up-regulating the Expression of This Molecule | [5] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Fisetin NP Info | + | Sorafenib Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 3 Up-regulating the Expression of This Molecule | [6] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | 6-shogaol NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 4 Up-regulating the Expression of This Molecule | [7] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Delphinidin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 5 Up-regulating the Expression of This Molecule | [8] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Alpha solanine NP Info | + | Cisplatin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 6 Up-regulating the Expression of This Molecule | [9] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | 6-dehydrogingerdione NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 7 Up-regulating the Expression of This Molecule | [10] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Periplocin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 8 Up-regulating the Expression of This Molecule | [11] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Carnosic acid NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 9 Up-regulating the Expression of This Molecule | [12] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Kaempferol NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 10 Up-regulating the Expression of This Molecule | [13] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Arsenic trioxide NP Info | + | 5-fluorouracil Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 11 Up-regulating the Expression of This Molecule | [14] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Magnolol NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 12 Up-regulating the Expression of This Molecule | [15] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Wogonin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 13 Up-regulating the Expression of This Molecule | [16] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Silibinin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 14 Up-regulating the Expression of This Molecule | [17] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Apigenin NP Info | + | TRAIL/Apo2L Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 15 Up-regulating the Expression of This Molecule | [18] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Morusin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 16 Up-regulating the Expression of This Molecule | [19] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Triptolide NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 17 Up-regulating the Expression of This Molecule | [20] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Apigenin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 18 Up-regulating the Expression of This Molecule | [21] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Chrysin NP Info | + | Cisplatin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 19 Up-regulating the Expression of This Molecule | [22] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Curcumin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 20 Up-regulating the Expression of This Molecule | [23] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Bufalin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 21 Up-regulating the Expression of This Molecule | [24] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Isoliquiritigenin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 22 Up-regulating the Expression of This Molecule | [25] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Chrysin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 23 Up-regulating the Expression of This Molecule | [26] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Phytosphingosine NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 24 Up-regulating the Expression of This Molecule | [27] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Sulforaphane NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 25 Up-regulating the Expression of This Molecule | [28] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Elemene NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 26 Up-regulating the Expression of This Molecule | [29] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Vernodalol NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 27 Up-regulating the Expression of This Molecule | [30] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Esculetin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 28 Up-regulating the Expression of This Molecule | [31] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Curcumin NP Info | + | Bacillus Calmette-Guerin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 29 Up-regulating the Expression of This Molecule | [32] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Gingerol NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 30 Up-regulating the Expression of This Molecule | [33] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Luteolin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 31 Up-regulating the Expression of This Molecule | [34] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Nimbolide NP Info | + | Tumor necrosis factor alpha Drug Info | |
Structure |
![]() |
+ |
![]() |