Skip to main content
  •   Home
  •   Download
  •   Manual
  •   Contact

Molecule Details

General Information of the Molecule
Name
Caspase-7 (CASP7)
Synonyms
MCH3; ICE-like apoptotic protease 3; ICE-LAP3; CMH-1; CASP-7; Apoptotic protease Mch-3
Gene Name
CASP7
Gene ID
840
Sequence
MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQY
NMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQ
DLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKL
FFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSW
FVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELY
FSQ
    Click to Show/Hide
Function
Involved in the activation cascade of caspases responsible for apoptosis execution. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Overexpression promotes programmed cell death.
    Click to Show/Hide
Uniprot ID
CASP7_HUMAN
EC Number
EC: 3.4.22.60
KEGG ID
hsa840
TTD ID
T72252
A List of Drug Combination(s) Able to Regulate This Molecule
          Activity Regulation     Click to Show/Hide the Drug Combination Regulating This Molecule
                 Up-regulation     Click to Show/Hide
                    Drug Combination 1 Up-regulating the Activity of This Molecule [1]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Gossypol   NP Info  + Zoledronic   Drug Info 
                    Structure +
                    Drug Combination 2 Up-regulating the Activity of This Molecule [2]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Genistein   NP Info  + Centchroman   Drug Info 
                    Structure +
                    Drug Combination 3 Up-regulating the Activity of This Molecule [3]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Borneol   NP Info  + Temozolomide   Drug Info 
                    Structure +
                    Drug Combination 4 Up-regulating the Activity of This Molecule [4]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Elemene   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 5 Up-regulating the Activity of This Molecule [5]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + Tolfenamic acid   Drug Info 
                    Structure +
                    Drug Combination 6 Up-regulating the Activity of This Molecule [6]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Epigallocatechin gallate   NP Info  + Vorinostat   Drug Info 
                    Structure +
          Cleavage Regulation     Click to Show/Hide the Drug Combination Regulating This Molecule
                 Up-regulation     Click to Show/Hide
                    Drug Combination 1 Up-regulating the Cleavage of This Molecule [7]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 2 Up-regulating the Cleavage of This Molecule [8]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Epigallocatechin gallate   NP Info  + Enoxacin   Drug Info 
                    Structure +
                    Drug Combination 3 Up-regulating the Cleavage of This Molecule [9]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Dihydroartemisinin   NP Info  + Doxorubicin   Drug Info 
                    Structure +
                    Drug Combination 4 Up-regulating the Cleavage of This Molecule [10]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Alpha solanine   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 5 Up-regulating the Cleavage of This Molecule [11]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Gambogic acid   NP Info  + Doxorubicin   Drug Info 
                    Structure +
                    Drug Combination 6 Up-regulating the Cleavage of This Molecule [12]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Resveratrol   NP Info  + Melphalan   Drug Info 
                    Structure +
                    Drug Combination 7 Up-regulating the Cleavage of This Molecule [13]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Daunorubicin   NP Info  + NL-101   Drug Info 
                    Structure +
                    Drug Combination 8 Up-regulating the Cleavage of This Molecule [4]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Elemene   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 9 Up-regulating the Cleavage of This Molecule [14]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + Nilotinib   Drug Info 
                    Structure +
                    Drug Combination 10 Up-regulating the Cleavage of This Molecule [15]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + 2-methoxyestradiol   Drug Info 
                    Structure +
                    Drug Combination 11 Up-regulating the Cleavage of This Molecule [16]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Vincristine   NP Info  + VE-465   Drug Info 
                    Structure +
                    Drug Combination 12 Up-regulating the Cleavage of This Molecule [17]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Apigenin   NP Info  + TNF-related apoptosis inducing ligand    Drug Info 
                    Structure +
                    Drug Combination 13 Up-regulating the Cleavage of This Molecule [18]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Paclitaxel   NP Info  + Alpelisib   Drug Info 
                    Structure +
                    Drug Combination 14 Up-regulating the Cleavage of This Molecule [19]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Chlorogenic acid   NP Info  + Regorafenib   Drug Info 
                    Structure +
                    Drug Combination 15 Up-regulating the Cleavage of This Molecule [20]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Resveratrol   NP Info  + TNF-related apoptosis inducing ligand    Drug Info 
                    Structure +
                    Drug Combination 16 Up-regulating the Cleavage of This Molecule [21]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Piperine   NP Info  + Celecoxib   Drug Info 
                    Structure +
                    Drug Combination 17 Up-regulating the Cleavage of This Molecule [22]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Theaflavin-3,3'-digallate + Black tea polyphenol + Cisplatin
    Click to Show/Hide the Each NP or Drug Structure of This Combination
Theaflavin-3,3'-digallate   NP Info     Drug Info 
Black tea polyphenol   NP Info 
                    Drug Combination 18 Up-regulating the Cleavage of This Molecule [23]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + Cotylenin A   Drug Info 
                    Structure +
                    Drug Combination 19 Up-regulating the Cleavage of This Molecule [24]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Gambogic acid   NP Info  + TNF-related apoptosis inducing ligand    Drug Info 
                    Structure +
          Expression Regulation     Click to Show/Hide the Drug Combination Regulating This Molecule
                 Up-regulation     Click to Show/Hide
                    Drug Combination 1 Up-regulating the Expression of This Molecule [25]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Bufalin   NP Info  + Sorafenib   Drug Info 
                    Structure +
                    Drug Combination 2 Up-regulating the Expression of This Molecule [26]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Fisetin   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 3 Up-regulating the Expression of This Molecule [27]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Artesunate   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 4 Up-regulating the Expression of This Molecule [28]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Matrine   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 5 Up-regulating the Expression of This Molecule [29]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + Buthionine sulfoximine   Drug Info 
                    Structure +
                    Drug Combination 6 Up-regulating the Expression of This Molecule [30]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Thymoquinone   NP Info  + Zoledronic   Drug Info 
                    Structure +
                    Drug Combination 7 Up-regulating the Expression of This Molecule [4]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Elemene   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 8 Up-regulating the Expression of This Molecule [6]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Epigallocatechin gallate   NP Info  + Vorinostat   Drug Info 
                    Structure +
                    Drug Combination 9 Up-regulating the Expression of This Molecule [19]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Chlorogenic acid   NP Info  + Regorafenib   Drug Info 
                    Structure +
                    Drug Combination 10 Up-regulating the Expression of This Molecule [31]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Celastrol   NP Info  + PHA665752   Drug Info 
                    Structure +
                    Drug Combination 11 Up-regulating the Expression of This Molecule [32]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + Etoposide   Drug Info 
                    Structure +
                    Drug Combination 12 Up-regulating the Expression of This Molecule [33]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Fisetin   NP Info  + Gemcitabine   Drug Info 
                    Structure +
References
Reference 1 Targeting apoptosis in the hormone- and drug-resistant prostate cancer cell line, DU-145, by gossypol/zoledronic acid combination. Cell Biol Int. 2009 Nov;33(11):1165-72.
Reference 2 Genistein synergizes centchroman action in human breast cancer cells. Indian J Pharmacol. Nov-Dec 2016;48(6):637-642.
Reference 3 Natural borneol is a novel chemosensitizer that enhances temozolomide-induced anticancer efficiency against human glioma by triggering mitochondrial dysfunction and reactive oxide species-mediated oxidative damage. Onco Targets Ther. 2018 Sep 4;11:5429-5439.
Reference 4 beta-Elemene, a novel plant-derived antineoplastic agent, increases cisplatin chemosensitivity of lung tumor cells by triggering apoptosis. Oncol Rep. 2009 Jul;22(1):161-70.
Reference 5 Combination of tolfenamic acid and curcumin induces colon cancer cell growth inhibition through modulating specific transcription factors and reactive oxygen species. Oncotarget. 2016 Jan 19;7(3):3186-200.
Reference 6 Anti-melanoma effects of vorinostat in combination with polyphenolic antioxidant (-)-epigallocatechin-3-gallate (EGCG). Pharm Res. 2010 Jun;27(6):1103-14.
Reference 7 Curcumin enhances cytotoxicity of chemotherapeutic agents in prostate cancer cells by inducing p21(WAF1/CIP1) and C/EBPbeta expressions and suppressing NF-kappaB activation. Prostate. 2002 May 15;51(3):211-8.
Reference 8 Enoxacin and Epigallocatechin Gallate (EGCG) Act Synergistically to Inhibit the Growth of Cervical Cancer Cells in Culture. Molecules. 2019 Apr 22;24(8):1580.
Reference 9 Synergistic anti-cancer activity of the combination of dihydroartemisinin and doxorubicin in breast cancer cells. Pharmacol Rep. 2013;65(2):453-9.
Reference 10 Synergistic Effect of Alpha-Solanine and Cisplatin Induces Apoptosis and Enhances Cell Cycle Arrest in Human Hepatocellular Carcinoma Cells. Anticancer Agents Med Chem. 2019;19(18):2197-2210.
Reference 11 Suppression of NF-KappaB signaling and P-glycoprotein function by gambogic acid synergistically potentiates adriamycin -induced apoptosis in lung cancer. Curr Cancer Drug Targets. 2014;14(1):91-103.
Reference 12 Resveratrol chemosensitizes breast cancer cells to melphalan by cell cycle arrest. J Cell Biochem. 2012 Aug;113(8):2586-96.
Reference 13 Novel SAHA?bendamustine hybrid NL?101 in combination with daunorubicin synergistically suppresses acute myeloid leukemia. Oncol Rep. 2020 Jul;44(1):273-282.
Reference 14 Endoplasmic reticulum stress-mediated apoptosis in imatinib-resistant leukemic K562-r cells triggered by AMN107 combined with arsenic trioxide. Exp Biol Med (Maywood). 2013 Aug 1;238(8):932-42.
Reference 15 2-methoxyestradiol induces mitotic arrest, apoptosis, and synergistic cytotoxicity with arsenic trioxide in human urothelial carcinoma cells. PLoS One. 2013 Aug 13;8(8):e68703.
Reference 16 Vincristine potentiates the anti-proliferative effect of an aurora kinase inhibitor, VE-465, in myeloid leukemia cells. Biochem Pharmacol. 2011 Dec 15;82(12):1884-90.
Reference 17 Ethanolic Extract of Propolis Augments TRAIL-Induced Apoptotic Death in Prostate Cancer Cells. Evid Based Complement Alternat Med. 2011;2011:535172.
Reference 18 PI3K-targeting strategy using alpelisib to enhance the antitumor effect of paclitaxel in human gastric cancer. Sci Rep. 2020 Jul 23;10(1):12308.
Reference 19 Chlorogenic Acid Improves the Regorafenib Effects in Human Hepatocellular Carcinoma Cells. Int J Mol Sci. 2018 May 19;19(5):1518.
Reference 20 Resveratrol sensitizes androgen independent prostate cancer cells to death-receptor mediated apoptosis through multiple mechanisms. Prostate. 2007 Nov 1;67(15):1641-53.
Reference 21 Piperine and Celecoxib synergistically inhibit colon cancer cell proliferation via modulating Wnt/beta-catenin signaling pathway. Phytomedicine. 2021 Apr;84:153484.
Reference 22 Synergistic effect of black tea polyphenol, theaflavin-3,3'-digallate with cisplatin against cisplatin resistant human ovarian cancer cells. J Funct Foods. 2018 Jul;46:1-11.
Reference 23 Cotylenin A and arsenic trioxide cooperatively suppress cell proliferation and cell invasion activity in human breast cancer cells. Int J Oncol. 2015 Feb;46(2):841-8.
Reference 24 Gambogic acid sensitizes breast cancer cells to TRAIL-induced apoptosis by promoting the crosstalk of extrinsic and intrinsic apoptotic signalings. Food Chem Toxicol. 2018 Sep;119:334-341.
Reference 25 Bufalin enhances the anti-proliferative effect of sorafenib on human hepatocellular carcinoma cells through downregulation of ERK. Mol Biol Rep. 2012 Feb;39(2):1683-9.
Reference 26 Anticancer activity of a combination of cisplatin and fisetin in embryonal carcinoma cells and xenograft tumors. Mol Cancer Ther. 2011 Feb;10(2):255-68.
Reference 27 Artesunate exhibits synergistic anti-cancer effects with cisplatin on lung cancer A549 cells by inhibiting MAPK pathway. Gene. 2021 Jan 15;766:145134.
Reference 28 Effects of matrine in combination with cisplatin on liver cancer. Oncol Lett. 2021 Jan;21(1):66.
Reference 29 Arsenic trioxide-induced apoptosis and its enhancement by buthionine sulfoximine in hepatocellular carcinoma cell lines. Biochem Biophys Res Commun. 2002 Mar 8;291(4):861-7.
Reference 30 Enhanced cytotoxicity and apoptosis by thymoquinone in combination with zoledronic acid in hormone- and drug-resistant prostate cancer cell lines. J BUON. Oct-Dec 2014;19(4):1055-61.
Reference 31 Celastrol exerts synergistic effects with PHA-665752 and inhibits tumor growth of c-Met-deficient hepatocellular carcinoma in vivo. Mol Biol Rep. 2013 Jul;40(7):4203-9.
Reference 32 Arsenic trioxide potentiates the effectiveness of etoposide in Ewing sarcomas. Int J Oncol. 2016 Nov;49(5):2135-2146.
Reference 33 Fisetin Enhances the Cytotoxicity of Gemcitabine by Down-regulating ERK-MYC in MiaPaca-2 Human Pancreatic Cancer Cells. Anticancer Res. 2018 Jun;38(6):3527-3533.
Cite NPCDR
Visitor Map
Correspondence

X. N. Sun, Y. T. Zhang, Y. Zhou, X. C. Lian, L. L. Yan, T. Pan, T. Jin, H. Xie, Z. M. Liang, W. Q. Qiu, J. X. Wang, Z. R. Li, F. Zhu*, X. B. Sui*. NPCDR: natural product-based drug combination and its disease-specific molecular regulation. Nucleic Acids Research. 50(D1): 1324-1333 (2020). PMID: 34664659

Prof. Feng ZHU  (zhufeng@zju.edu.cn)

College of Pharmaceutical Sciences, Zhejiang University, Hangzhou, China


Prof. Xinbing SUI  (hzzju@hznu.edu.cn)

School of Pharmacy and Department of Medical Oncology, the Affiliated Hospital of Hangzhou Normal University, Hangzhou Normal University, Hangzhou, China