Molecule Details
| General Information of the Molecule | ||||
|---|---|---|---|---|
| Name |
MAP1A/MAP1B light chain 3 A (MAP1LC3A)
|
|||
| Synonyms |
Autophagy-related protein LC3 A; Autophagy-related ubiquitin-like modifier LC3 A; MAP1 light chain 3-like protein 1; MAP1A/MAP1B light chain 3 A; MAP1A/MAP1B LC3 A; Microtubule-associated proteins 1 light chain 3A
|
|||
| Gene Name |
MAP1LC3A
|
|||
| Gene ID | ||||
| Sequence |
MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNM
SELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFG F Click to Show/Hide
|
|||
| Function |
Ubiquitin-like modifier involved in formation of autophagosomal vacuoles (autophagosomes). While LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation. Through its interaction with the reticulophagy receptor TEX264, participates in the remodeling of subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover.
Click to Show/Hide
|
|||
| Uniprot ID | ||||
| Pfam | ||||
| KEGG ID | ||||
| A List of Drug Combination(s) Able to Regulate This Molecule | ||||
|---|---|---|---|---|
| Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
| Down-regulation | Click to Show/Hide | |||
| Drug Combination 1 Down-regulating the Expression of This Molecule | ||||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Resveratrol NP Info | + | Doxorubicin Drug Info | |
| Drug Combination 2 Down-regulating the Expression of This Molecule | [1] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Resveratrol NP Info | + | Doxorubicin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 3 Down-regulating the Expression of This Molecule | [2] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Arsenic trioxide NP Info | + | 1,3-bis(2-chloroethyl)-1-nitrosourea Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 4 Down-regulating the Expression of This Molecule | [3] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Arctigenin NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 5 Down-regulating the Expression of This Molecule | [4] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Tangeretin NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 6 Down-regulating the Expression of This Molecule | [5] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Arsenic trioxide NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 7 Down-regulating the Expression of This Molecule | [6] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Epigallocatechin gallate NP Info | + | Doxorubicin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 8 Down-regulating the Expression of This Molecule | [7] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Sulforaphane NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 9 Down-regulating the Expression of This Molecule | [8] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Methylglyoxal | + | Doxorubicin + Cisplatin | |
| Click to Show/Hide the Each NP or Drug Structure of This Combination | ||||
| Methylglyoxal NP Info | Drug Info | |||
|
|
|||
| Drug Info | ||||
|
|
|||
| Drug Combination 10 Down-regulating the Expression of This Molecule | [9] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Sulforaphane NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 11 Down-regulating the Expression of This Molecule | [10] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Resveratrol NP Info | + | Rapamycin Drug Info | |
| Structure |
|
+ |
|
|
| Up-regulation | Click to Show/Hide | |||
| Drug Combination 1 Up-regulating the Expression of This Molecule | [11] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Acteoside NP Info | + | Temozolomide Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 2 Up-regulating the Expression of This Molecule | [12] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Capsaicin NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 3 Up-regulating the Expression of This Molecule | [13] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Deguelin NP Info | + | Doxorubicin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 4 Up-regulating the Expression of This Molecule | [14] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Gambogic acid NP Info | + | Chloroquine Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 5 Up-regulating the Expression of This Molecule | [15] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Arsenic trioxide NP Info | + | MG132 Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 6 Up-regulating the Expression of This Molecule | [16] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Gamabufotalin NP Info | + | Arsenite Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 7 Up-regulating the Expression of This Molecule | [17] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Scutellarin NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 8 Up-regulating the Expression of This Molecule | [18] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Metformin NP Info | + | Sorafenib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 9 Up-regulating the Expression of This Molecule | [3] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Arctigenin NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 10 Up-regulating the Expression of This Molecule | [19] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Vinblastine NP Info | + | Nanoliposomal C6-ceramide Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 11 Up-regulating the Expression of This Molecule | [20] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Neferine NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 12 Up-regulating the Expression of This Molecule | [21] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Honokiol NP Info | + | Chloroquine Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 13 Up-regulating the Expression of This Molecule | [22] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Arsenic trioxide NP Info | + | Bortezomib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 14 Up-regulating the Expression of This Molecule | [23] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Arsenic trioxide NP Info | + | Androgen Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 15 Up-regulating the Expression of This Molecule | [24] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Arsenic trioxide NP Info | + | Chloroquine Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 16 Up-regulating the Expression of This Molecule | [25] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Vitamin D NP Info | + | Temozolomide Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 17 Up-regulating the Expression of This Molecule | [26] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Kaempferol NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 18 Up-regulating the Expression of This Molecule | [27] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Voacamine NP Info | + | Doxorubicin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 19 Up-regulating the Expression of This Molecule | [28] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Celastrol NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 20 Up-regulating the Expression of This Molecule | [29] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Resveratrol NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 21 Up-regulating the Expression of This Molecule | [30] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Arsenic trioxide NP Info | + | Everolimus Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 22 Up-regulating the Expression of This Molecule | [31] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Genistein NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 23 Up-regulating the Expression of This Molecule | [32] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Pterostilbene NP Info | + | Sorafenib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 24 Up-regulating the Expression of This Molecule | [33] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Oridonin NP Info | + | Cetuximab Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 25 Up-regulating the Expression of This Molecule | [34] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Elemene NP Info | + | Oxaliplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 26 Up-regulating the Expression of This Molecule | [35] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Arsenic trioxide NP Info | + | Sorafenib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 27 Up-regulating the Expression of This Molecule | [8] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Methylglyoxal | + | Doxorubicin + Cisplatin | |
| Click to Show/Hide the Each NP or Drug Structure of This Combination | ||||
| Methylglyoxal NP Info | Drug Info | |||
|
|
|||
| Drug Info | ||||
|
|
|||
| Drug Combination 28 Up-regulating the Expression of This Molecule | [36] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Gossypol NP Info | + | BRD4770 Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 29 Up-regulating the Expression of This Molecule | [37] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Gingerol NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 30 Up-regulating the Expression of This Molecule | [38] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Arsenic trioxide NP Info | + | Thalidomide Drug Info | |
| Structure |
|
+ |
|
|