Molecule Details
| General Information of the Molecule | ||||
|---|---|---|---|---|
| Name |
Bcl-2-like protein 3 (MCL1)
|
|||
| Synonyms |
Induced myeloid leukemia cell differentiation protein Mcl-1; mcl1/EAT; Bcl2-L-3; Bcl-2-related protein EAT/mcl1; Bcl-2-like protein 3; BCL2L3
|
|||
| Gene Name |
MCL1
|
|||
| Gene ID | ||||
| Sequence |
MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS
AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR Click to Show/Hide
|
|||
| Function |
Mediates its effects by interactions with a number of other regulators of apoptosis. Isoform 1 inhibits apoptosis. Isoform 2 promotes apoptosis. Involved in the regulation of apoptosis versus cell survival, and in the maintenance of viability but not of proliferation.
Click to Show/Hide
|
|||
| Uniprot ID | ||||
| Pfam | ||||
| KEGG ID | ||||
| TTD ID | ||||
| A List of Drug Combination(s) Able to Regulate This Molecule | ||||
|---|---|---|---|---|
| Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
| Down-regulation | Click to Show/Hide | |||
| Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Dicoumarol NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 2 Down-regulating the Expression of This Molecule | [2] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Triptolide NP Info | + | Vasostatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 3 Down-regulating the Expression of This Molecule | [3] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Triptolide NP Info | + | Gemcitabine Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 4 Down-regulating the Expression of This Molecule | [4] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Fisetin NP Info | + | Sorafenib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 5 Down-regulating the Expression of This Molecule | [5] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Shikonin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 6 Down-regulating the Expression of This Molecule | [6] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Triptolide NP Info | + | Venetoclax Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 7 Down-regulating the Expression of This Molecule | [7] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Apigenin NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 8 Down-regulating the Expression of This Molecule | [8] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Paclitaxel NP Info | + | ABT-737 Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 9 Down-regulating the Expression of This Molecule | [9] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Apigenin NP Info | + | ABT-263 Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 10 Down-regulating the Expression of This Molecule | [10] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Magnolol NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 11 Down-regulating the Expression of This Molecule | [11] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Bufalin NP Info | + | Osimertinib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 12 Down-regulating the Expression of This Molecule | [12] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Gossypol NP Info | + | Imatinib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 13 Down-regulating the Expression of This Molecule | [13] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Triptolide NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 14 Down-regulating the Expression of This Molecule | [14] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Vitamin K2 NP Info | + | Sorafenib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 15 Down-regulating the Expression of This Molecule | [15] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Arsenic trioxide NP Info | + | ABT-737 Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 16 Down-regulating the Expression of This Molecule | [16] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Honokiol NP Info | + | Osimertinib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 17 Down-regulating the Expression of This Molecule | [17] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Vincristine NP Info | + | Belinostat Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 18 Down-regulating the Expression of This Molecule | [18] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Bufalin NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 19 Down-regulating the Expression of This Molecule | [19] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Bufalin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 20 Down-regulating the Expression of This Molecule | [20] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Silibinin NP Info | + | Vorinostat Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 21 Down-regulating the Expression of This Molecule | [21] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Flavopiridol NP Info | + | Venetoclax Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 22 Down-regulating the Expression of This Molecule | [22] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Curcumin NP Info | + | Thioridazine Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 23 Down-regulating the Expression of This Molecule | [23] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Silibinin NP Info | + | Sorafenib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 24 Down-regulating the Expression of This Molecule | [24] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Vernodalol NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 25 Down-regulating the Expression of This Molecule | [25] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Gambogic acid NP Info | + | Imatinib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 26 Down-regulating the Expression of This Molecule | [26] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Betulinic Acid NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 27 Down-regulating the Expression of This Molecule | [27] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Daunorubicin NP Info | + | PP242 Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 28 Down-regulating the Expression of This Molecule | [28] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Galangin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 29 Down-regulating the Expression of This Molecule | [29] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Wogonin NP Info | + | ABT-263 Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 30 Down-regulating the Expression of This Molecule | [30] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Arsenic trioxide NP Info | + | Lonidamine Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 31 Down-regulating the Expression of This Molecule | [31] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Arsenic trioxide NP Info | + | Rapamycin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 32 Down-regulating the Expression of This Molecule | [32] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Vincristine NP Info | + | Vorinostat Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 33 Down-regulating the Expression of This Molecule | [33] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Luteolin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 34 Down-regulating the Expression of This Molecule | [34] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Curcumin NP Info | + | Dactolisib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 35 Down-regulating the Expression of This Molecule | [20] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Silibinin NP Info | + | Trichostatin A Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 36 Down-regulating the Expression of This Molecule | [35] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Amentoflavone NP Info | + | Sorafenib Drug Info | |
| Structure |
|
+ |
|
|
| Up-regulation | Click to Show/Hide | |||
| Drug Combination 1 Up-regulating the Expression of This Molecule | [37] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Fisetin NP Info | + | Cabazitaxel Drug Info | |
| Structure |
|
+ |
|
|
| Phosphorylation Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
| Down-regulation | Click to Show/Hide | |||
| Drug Combination 1 Down-regulating the Phosphorylation of This Molecule | [36] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Neferine NP Info | + | Imatinib Drug Info | |
| Structure |
|
+ |
|
|
| Up-regulation | Click to Show/Hide | |||
| Drug Combination 1 Up-regulating the Phosphorylation of This Molecule | [38] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Arsenic trioxide NP Info | + | Buthionine sulfoximine Drug Info | |
| Structure |
|
+ |
|
|
| Natural Product(s) of This Target | ||||
|---|---|---|---|---|
| 1 | 5,7,4'-Trimethoxyflavone | NP Info | . | Not Available |
| 2 | Amentoflavone | NP Info | Investigative | Gingko biloba |
| 3 | Morin | NP Info | Investigative | Morus serrata |
| 4 | Narciclasine | NP Info | . | Not Available |
| 5 | Rosmarinic acid | NP Info | Investigative | Salvia rosmarinus |
| Drug(s) of This Target | ||||
|---|---|---|---|---|
| 1 | Cisplatin | Drug Info | Approved | Bladder cancer |