Molecule Details
General Information of the Molecule | ||||
---|---|---|---|---|
Name |
Bcl-2-like protein 3 (MCL1)
|
|||
Synonyms |
Induced myeloid leukemia cell differentiation protein Mcl-1; mcl1/EAT; Bcl2-L-3; Bcl-2-related protein EAT/mcl1; Bcl-2-like protein 3; BCL2L3
|
|||
Gene Name |
MCL1
|
|||
Gene ID | ||||
Sequence |
MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS
AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR Click to Show/Hide
|
|||
Function |
Mediates its effects by interactions with a number of other regulators of apoptosis. Isoform 1 inhibits apoptosis. Isoform 2 promotes apoptosis. Involved in the regulation of apoptosis versus cell survival, and in the maintenance of viability but not of proliferation.
Click to Show/Hide
|
|||
Uniprot ID | ||||
Pfam | ||||
KEGG ID | ||||
TTD ID |
A List of Drug Combination(s) Able to Regulate This Molecule | ||||
---|---|---|---|---|
Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Down-regulation | Click to Show/Hide | |||
Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Dicoumarol NP Info | + | Cisplatin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 2 Down-regulating the Expression of This Molecule | [2] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Triptolide NP Info | + | Vasostatin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 3 Down-regulating the Expression of This Molecule | [3] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Triptolide NP Info | + | Gemcitabine Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 4 Down-regulating the Expression of This Molecule | [4] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Fisetin NP Info | + | Sorafenib Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 5 Down-regulating the Expression of This Molecule | [5] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Shikonin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 6 Down-regulating the Expression of This Molecule | [6] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Triptolide NP Info | + | Venetoclax Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 7 Down-regulating the Expression of This Molecule | [7] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Apigenin NP Info | + | 5-fluorouracil Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 8 Down-regulating the Expression of This Molecule | [8] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Paclitaxel NP Info | + | ABT-737 Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 9 Down-regulating the Expression of This Molecule | [9] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Apigenin NP Info | + | ABT-263 Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 10 Down-regulating the Expression of This Molecule | [10] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Magnolol NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 11 Down-regulating the Expression of This Molecule | [11] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Bufalin NP Info | + | Osimertinib Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 12 Down-regulating the Expression of This Molecule | [12] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Gossypol NP Info | + | Imatinib Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 13 Down-regulating the Expression of This Molecule | [13] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Triptolide NP Info | + | Cisplatin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 14 Down-regulating the Expression of This Molecule | [14] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Vitamin K2 NP Info | + | Sorafenib Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 15 Down-regulating the Expression of This Molecule | [15] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Arsenic trioxide NP Info | + | ABT-737 Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 16 Down-regulating the Expression of This Molecule | [16] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Honokiol NP Info | + | Osimertinib Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 17 Down-regulating the Expression of This Molecule | [17] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Vincristine NP Info | + | Belinostat Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 18 Down-regulating the Expression of This Molecule | [18] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Bufalin NP Info | + | 5-fluorouracil Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 19 Down-regulating the Expression of This Molecule | [19] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Bufalin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 20 Down-regulating the Expression of This Molecule | [20] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Silibinin NP Info | + | Vorinostat Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 21 Down-regulating the Expression of This Molecule | [21] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Flavopiridol NP Info | + | Venetoclax Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 22 Down-regulating the Expression of This Molecule | [22] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Curcumin NP Info | + | Thioridazine Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 23 Down-regulating the Expression of This Molecule | [23] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Silibinin NP Info | + | Sorafenib Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 24 Down-regulating the Expression of This Molecule | [24] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Vernodalol NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 25 Down-regulating the Expression of This Molecule | [25] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Gambogic acid NP Info | + | Imatinib Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 26 Down-regulating the Expression of This Molecule | [26] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Betulinic Acid NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 27 Down-regulating the Expression of This Molecule | [27] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Daunorubicin NP Info | + | PP242 Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 28 Down-regulating the Expression of This Molecule | [28] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Galangin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 29 Down-regulating the Expression of This Molecule | [29] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Wogonin NP Info | + | ABT-263 Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 30 Down-regulating the Expression of This Molecule | [30] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Arsenic trioxide NP Info | + | Lonidamine Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 31 Down-regulating the Expression of This Molecule | [31] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Arsenic trioxide NP Info | + | Rapamycin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 32 Down-regulating the Expression of This Molecule | [32] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Vincristine NP Info | + | Vorinostat Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 33 Down-regulating the Expression of This Molecule | [33] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Luteolin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 34 Down-regulating the Expression of This Molecule | [34] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Curcumin NP Info | + | Dactolisib Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 35 Down-regulating the Expression of This Molecule | [20] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Silibinin NP Info | + | Trichostatin A Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 36 Down-regulating the Expression of This Molecule | [35] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Amentoflavone NP Info | + | Sorafenib Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Up-regulation | Click to Show/Hide | |||
Drug Combination 1 Up-regulating the Expression of This Molecule | [37] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Fisetin NP Info | + | Cabazitaxel Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Phosphorylation Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Down-regulation | Click to Show/Hide | |||
Drug Combination 1 Down-regulating the Phosphorylation of This Molecule | [36] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Neferine NP Info | + | Imatinib Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Up-regulation | Click to Show/Hide | |||
Drug Combination 1 Up-regulating the Phosphorylation of This Molecule | [38] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Arsenic trioxide NP Info | + | Buthionine sulfoximine Drug Info | |
Structure |
![]() |
+ |
![]() |
Natural Product(s) of This Target | ||||
---|---|---|---|---|
1 | Amentoflavone | NP Info | Investigative | Gingko biloba |
2 | Morin | NP Info | Investigative | Morus serrata |
3 | Rosmarinic acid | NP Info | Investigative | Salvia rosmarinus |