Molecule Details
General Information of the Molecule | ||||
---|---|---|---|---|
Name |
Vascular endothelial growth factor A (VEGFA)
|
|||
Synonyms |
Vascular permeability factor; VPF; VEGF-A; VEGF
|
|||
Gene Name |
VEGFA
|
|||
Gene ID | ||||
Sequence |
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD
IFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEM SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPG PHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR Click to Show/Hide
|
|||
Function |
Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth. Binding to NRP1 receptor initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development. Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth.
Click to Show/Hide
|
|||
Uniprot ID | ||||
Pfam | ||||
KEGG ID | ||||
TTD ID |
A List of Drug Combination(s) Able to Regulate This Molecule | ||||
---|---|---|---|---|
Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Down-regulation | Click to Show/Hide | |||
Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Genistein NP Info | + | N-(4-hydroxyphenyl) retinamide Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 2 Down-regulating the Expression of This Molecule | [2] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Pterostilbene NP Info | + | Vorinostat Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 3 Down-regulating the Expression of This Molecule | [3] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Resveratrol NP Info | + | 5-fluorouracil Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 4 Down-regulating the Expression of This Molecule | [4] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Ellagic acid NP Info | + | Temozolomide Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 5 Down-regulating the Expression of This Molecule | [5] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Schisandrol B NP Info | + | Doxorubicin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 6 Down-regulating the Expression of This Molecule | [6] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Thymoquinone NP Info | + | Bortezomib Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 7 Down-regulating the Expression of This Molecule | [7] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Curcumin NP Info | + | Celecoxib Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 8 Down-regulating the Expression of This Molecule | [8] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Triptolide NP Info | + | AMD3100 Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 9 Down-regulating the Expression of This Molecule | [9] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Honokiol NP Info | + | Celecoxib Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 10 Down-regulating the Expression of This Molecule | [10] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Epigallocatechin gallate NP Info | + | 5-fluorouracil Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 11 Down-regulating the Expression of This Molecule | [11] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Ursolic acid NP Info | + | Gemcitabine Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 12 Down-regulating the Expression of This Molecule | [12] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Triptolide NP Info | + | 5-LOX shRNA Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 13 Down-regulating the Expression of This Molecule | [13] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Curcumin NP Info | + | Capecitabine Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 14 Down-regulating the Expression of This Molecule | [14] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Epigallocatechin gallate NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 15 Down-regulating the Expression of This Molecule | [15] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Apigenin NP Info | + | HA14-1 Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 16 Down-regulating the Expression of This Molecule | [16] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Ginsenoside Rg3 NP Info | + | Gemcitabine Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 17 Down-regulating the Expression of This Molecule | [17] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Pinocembrin NP Info | + | Simvastatin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 18 Down-regulating the Expression of This Molecule | [18] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Quercetin NP Info | + | 2-methoxyestradiol Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 19 Down-regulating the Expression of This Molecule | [19] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Epigallocatechin gallate NP Info | + | Celecoxib Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 20 Down-regulating the Expression of This Molecule | [20] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Gambogic acid NP Info | + | Sunitinib Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 21 Down-regulating the Expression of This Molecule | [21] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Ginsenoside Rg3 NP Info | + | Endostar Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 22 Down-regulating the Expression of This Molecule | [22] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Curcumin NP Info | + | Gemcitabine Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 23 Down-regulating the Expression of This Molecule | [23] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Resveratrol NP Info | + | Gemcitabine Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 24 Down-regulating the Expression of This Molecule | [24] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Noscapine NP Info | + | Doxorubicin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 25 Down-regulating the Expression of This Molecule | [25] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Epigallocatechin gallate NP Info | + | SU5416 Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 26 Down-regulating the Expression of This Molecule | [26] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Noscapine NP Info | + | Gemcitabine Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 27 Down-regulating the Expression of This Molecule | [27] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Cordycepin NP Info | + | Apatinib Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 28 Down-regulating the Expression of This Molecule | [28] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Shikonin NP Info | + | Gemcitabine Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 29 Down-regulating the Expression of This Molecule | [29] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Curcumin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 30 Down-regulating the Expression of This Molecule | [30] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Ursolic acid NP Info | + | Capecitabine Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 31 Down-regulating the Expression of This Molecule | [31] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Ginsenoside Rg3 NP Info | + | Cyclophosphamide Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 32 Down-regulating the Expression of This Molecule | [32] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Thymoquinone NP Info | + | 5-fluorouracil Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 33 Down-regulating the Expression of This Molecule | [33] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Ginsenoside Rg3 NP Info | + | Capecitabine Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 34 Down-regulating the Expression of This Molecule | [34] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Allyl isothiocyanate NP Info | + | Celecoxib Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 35 Down-regulating the Expression of This Molecule | [35] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Arsenic trioxide NP Info | + | Sorafenib Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 36 Down-regulating the Expression of This Molecule | [36] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Tetrandrine NP Info | + | Cisplatin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 37 Down-regulating the Expression of This Molecule | [37] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Curcumin NP Info | + | Bacillus Calmette-Guerin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 38 Down-regulating the Expression of This Molecule | [38] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Arsenic trioxide NP Info | + | Thalidomide Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Up-regulation | Click to Show/Hide | |||
Drug Combination 1 Up-regulating the Expression of This Molecule | [39] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Exemestane | + | Triptorelin + Cisplatin | |
Click to Show/Hide the Each NP or Drug Structure of This Combination | ||||
Exemestane NP Info | Drug Info | |||
![]() |
![]() |
|||
Drug Info | ||||
![]() |
![]() |
|||
Drug Combination 2 Up-regulating the Expression of This Molecule | [40] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Arsenic trioxide NP Info | + | PX-478 Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 3 Up-regulating the Expression of This Molecule | [41] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Artesunate NP Info | + | Tetramethylpyrazine Drug Info | |
Structure |
![]() |
+ |
![]() |
Natural Product(s) of This Target | ||||
---|---|---|---|---|
1 | Polydatin | NP Info | Investigative | Polygonum cuspidatum |
2 | Wogonoside | NP Info | Investigative | Scutellaria baicalensis |
Drug(s) of This Target | ||||
---|---|---|---|---|
1 | 25-methoxyl-dammarane-3beta, 12beta, 20-triol | Drug Info | Investigative | Breast cancer |
2 | Bevacizumab | Drug Info | Approved | Colorectal cancer |