Molecule Details
| General Information of the Molecule | ||||
|---|---|---|---|---|
| Name |
Tumor necrosis factor (TNF)
|
|||
| Synonyms |
Tumour necrosis factor alpha; Tumour necrosis factor; Tumor necrosis factor ligand superfamily member 2; TNFalpha; TNFSF2; TNFA; TNF-alpha; TNF-a; TNF alpha; Cachectin
|
|||
| Gene Name |
TNF
|
|||
| Gene ID | ||||
| Sequence |
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL Click to Show/Hide
|
|||
| Function |
It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Impairs regulatory T-cells (Treg) function in individuals with rheumatoid arthritis via FOXP3 dephosphorylation. Upregulates the expression of protein phosphatase 1 (PP1), which dephosphorylates the key 'Ser-418' residue of FOXP3, thereby inactivating FOXP3 and rendering Treg cells functionally defective. Key mediator of cell death in the anticancer action of BCG-stimulated neutrophils in combination with DIABLO/SMAC mimetic in the RT4v6 bladder cancer cell line. Induces insulin resistance in adipocytes via inhibition of insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake. Induces GKAP42 protein degradation in adipocytes which is partially responsible for TNF-induced insulin resistance. Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR.
Click to Show/Hide
|
|||
| Uniprot ID | ||||
| Pfam | ||||
| KEGG ID | ||||
| TTD ID | ||||
| A List of Drug Combination(s) Able to Regulate This Molecule | ||||
|---|---|---|---|---|
| Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
| Down-regulation | Click to Show/Hide | |||
| Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Polydatin NP Info | + | N-palmitoylethanolamine Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 2 Down-regulating the Expression of This Molecule | [2] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Thymoquinone NP Info | + | Bortezomib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 3 Down-regulating the Expression of This Molecule | [3] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Gentiopicroside | + | Leflunomide + Methotrexate | |
| Click to Show/Hide the Each NP or Drug Structure of This Combination | ||||
| Gentiopicroside NP Info | Drug Info | |||
|
|
|||
| Drug Info | ||||
|
|
|||
| Drug Combination 4 Down-regulating the Expression of This Molecule | [4] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Acteoside NP Info | + | Thymic stromal lymphopoietin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 5 Down-regulating the Expression of This Molecule | [5] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Ferulic acid NP Info | + | Atorvastatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 6 Down-regulating the Expression of This Molecule | [6] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Apigenin NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 7 Down-regulating the Expression of This Molecule | [7] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Trandolapril NP Info | + | Paricalcitol Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 8 Down-regulating the Expression of This Molecule | [8] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Sesquiterpene lactone NP Info | + | Benznidazole Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 9 Down-regulating the Expression of This Molecule | [9] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Epigallocatechin gallate NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 10 Down-regulating the Expression of This Molecule | [10] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Glatiramer acetate NP Info | + | Atorvastatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 11 Down-regulating the Expression of This Molecule | [11] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Urolithin A NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 12 Down-regulating the Expression of This Molecule | [12] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Acovenoside A NP Info | + | Doxorubicin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 13 Down-regulating the Expression of This Molecule | [13] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Acteoside NP Info | + | Dextran sulfate sodium Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 14 Down-regulating the Expression of This Molecule | [14] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Vitamin C | + | Diazinon + Ceftriaxone | |
| Click to Show/Hide the Each NP or Drug Structure of This Combination | ||||
| Vitamin C NP Info | Drug Info | |||
|
|
|||
| Drug Info | ||||
|
|
|||
| Drug Combination 15 Down-regulating the Expression of This Molecule | [15] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Semaglutide NP Info | + | Rosiglitazone Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 16 Down-regulating the Expression of This Molecule | [16] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Acarbose NP Info | + | Cyclosporin Drug Info | |
| Structure |
|
+ |
|
|
| Up-regulation | Click to Show/Hide | |||
| Drug Combination 1 Up-regulating the Expression of This Molecule | [18] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Miltefosine NP Info | + | Paromomycin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 2 Up-regulating the Expression of This Molecule | [19] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Metformin NP Info | + | Sorafenib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 3 Up-regulating the Expression of This Molecule | [20] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Vincristine NP Info | + | Combretastatin A-4 phosphate Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 4 Up-regulating the Expression of This Molecule | [21] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Curcumin NP Info | + | Anti-PD-1 antibody Drug Info | |
| Structure |
|
+ |
|
|
| Secretion Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
| Down-regulation | Click to Show/Hide | |||
| Drug Combination 1 Down-regulating the Secretion of This Molecule | [17] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Aloin NP Info | + | Doxorubicin Drug Info | |
| Structure |
|
+ |
|
|
| Natural Product(s) of This Target | ||||
|---|---|---|---|---|
| 1 | Astilbin | NP Info | Investigative | Smilax glabra |
| 2 | Celastrol | NP Info | Preclinical | Celastrus strigillosus |
| 3 | Magnolol | NP Info | Investigative | Magnolia officinalis |
| 4 | Osthole | NP Info | Investigative | Angelica pubescens |
| Drug(s) of This Target | ||||
|---|---|---|---|---|
| 1 | Lenalidomide | Drug Info | Approved | Multiple myeloma |
| 2 | Thalidomide | Drug Info | Approved | Multiple myeloma |