Molecule Details
| General Information of the Molecule | ||||
|---|---|---|---|---|
| Name |
CDK-interacting protein 1 (CDKN1A)
|
|||
| Synonyms |
Melanoma differentiation-associated protein 6; WAF1; SDI1; PIC1; P21(WAF1); P21; Melanoma differentiation associated protein 6; MDA6; MDA-6; Cyclin-dependent kinase inhibitor 1; CIP1; CDK-interacting protein 1; CAP20
|
|||
| Gene Name |
CDKN1A
|
|||
| Gene ID | ||||
| Sequence |
MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLE
GDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLV PRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP Click to Show/Hide
|
|||
| Function |
May be involved in p53/TP53 mediated inhibition of cellular proliferation in response to DNA damage. Binds to and inhibits cyclin-dependent kinase activity, preventing phosphorylation of critical cyclin-dependent kinase substrates and blocking cell cycle progression. Functions in the nuclear localization and assembly of cyclin D-CDK4 complex and promotes its kinase activity towards RB1. At higher stoichiometric ratios, inhibits the kinase activity of the cyclin D-CDK4 complex. Inhibits DNA synthesis by DNA polymerase delta by competing with POLD3 for PCNA binding. Plays an important role in controlling cell cycle progression and DNA damage-induced G2 arrest.
Click to Show/Hide
|
|||
| Uniprot ID | ||||
| Pfam | ||||
| KEGG ID | ||||
| TTD ID | ||||
| A List of Drug Combination(s) Able to Regulate This Molecule | ||||
|---|---|---|---|---|
| Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
| Down-regulation | Click to Show/Hide | |||
| Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Flavopiridol NP Info | + | Depsipeptide Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 2 Down-regulating the Expression of This Molecule | [2] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Vicenin-2 NP Info | + | Radiation Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 3 Down-regulating the Expression of This Molecule | [3] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Metformin NP Info | + | Gemigliptin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 4 Down-regulating the Expression of This Molecule | ||||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Ursolic acid NP Info | + | Doxorubicin Drug Info | |
| Drug Combination 5 Down-regulating the Expression of This Molecule | [4] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Ursolic acid NP Info | + | Doxorubicin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 6 Down-regulating the Expression of This Molecule | [5] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Triptolide NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 7 Down-regulating the Expression of This Molecule | [6] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Resveratrol NP Info | + | Clofarabine Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 8 Down-regulating the Expression of This Molecule | [7] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Flavopiridol NP Info | + | Irinotecan Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 9 Down-regulating the Expression of This Molecule | [8] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Epigallocatechin gallate NP Info | + | Erlotinib Drug Info | |
| Structure |
|
+ |
|
|
| Up-regulation | Click to Show/Hide | |||
| Drug Combination 1 Up-regulating the Expression of This Molecule | [9] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Metformin NP Info | + | Nelfinavir Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 2 Up-regulating the Expression of This Molecule | [10] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Curcumin NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 3 Up-regulating the Expression of This Molecule | [11] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Curcumin NP Info | + | Carfilzomib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 4 Up-regulating the Expression of This Molecule | [12] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Elemene NP Info | + | Etoposide Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 5 Up-regulating the Expression of This Molecule | ||||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Resveratrol NP Info | + | Doxorubicin Drug Info | |
| Drug Combination 6 Up-regulating the Expression of This Molecule | [13] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Resveratrol NP Info | + | Doxorubicin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 7 Up-regulating the Expression of This Molecule | [14] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Resveratrol NP Info | + | Mitomycin C Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 8 Up-regulating the Expression of This Molecule | [15] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Fisetin NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 9 Up-regulating the Expression of This Molecule | [16] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Genistein NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 10 Up-regulating the Expression of This Molecule | [17] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Apigenin NP Info | + | Sorafenib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 11 Up-regulating the Expression of This Molecule | [18] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Curcumin NP Info | + | Mitomycin C Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 12 Up-regulating the Expression of This Molecule | [19] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Chrysin NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 13 Up-regulating the Expression of This Molecule | [20] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Dicoumarol NP Info | + | Doxorubicin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 14 Up-regulating the Expression of This Molecule | ||||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | luteolin NP Info | + | 5-Fluorouracil Drug Info | |
| Drug Combination 15 Up-regulating the Expression of This Molecule | [21] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Luteolin NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 16 Up-regulating the Expression of This Molecule | [22] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Tretinoin NP Info | + | Primaquin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 17 Up-regulating the Expression of This Molecule | [23] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Genistein NP Info | + | Dexamethasone Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 18 Up-regulating the Expression of This Molecule | [24] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Apigenin NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 19 Up-regulating the Expression of This Molecule | [25] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Artemisinin NP Info | + | Halofuginone Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 20 Up-regulating the Expression of This Molecule | [26] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Triptolide NP Info | + | Aspirin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 21 Up-regulating the Expression of This Molecule | [27] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Artesunate NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 22 Up-regulating the Expression of This Molecule | [28] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Flavopiridol NP Info | + | Gemcitabine Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 23 Up-regulating the Expression of This Molecule | [29] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Betulinic Acid NP Info | + | Sorafenib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 24 Up-regulating the Expression of This Molecule | [30] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Elemene NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 25 Up-regulating the Expression of This Molecule | [31] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Gambogic acid NP Info | + | Sunitinib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 26 Up-regulating the Expression of This Molecule | [32] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Curcumin NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 27 Up-regulating the Expression of This Molecule | [33] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Curcumin NP Info | + | Gemcitabine Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 28 Up-regulating the Expression of This Molecule | [34] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Epigallocatechin gallate NP Info | + | SU5416 Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 29 Up-regulating the Expression of This Molecule | [35] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Vitamin K2 NP Info | + | Sorafenib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 30 Up-regulating the Expression of This Molecule | [36] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Curcumin NP Info | + | Carboplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 31 Up-regulating the Expression of This Molecule | [37] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Genistein NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 32 Up-regulating the Expression of This Molecule | [38] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Honokiol NP Info | + | Rosiglitazone Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 33 Up-regulating the Expression of This Molecule | [39] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Epigallocatechin gallate NP Info | + | Sodium butyrate Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 34 Up-regulating the Expression of This Molecule | [40] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Nobiletin NP Info | + | Sorafenib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 35 Up-regulating the Expression of This Molecule | [41] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Noscapine NP Info | + | Gemcitabine Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 36 Up-regulating the Expression of This Molecule | [42] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Curcumin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 37 Up-regulating the Expression of This Molecule | [43] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Arsenic trioxide NP Info | + | Vorinostat Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 38 Up-regulating the Expression of This Molecule | [44] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Ursolic acid NP Info | + | Capecitabine Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 39 Up-regulating the Expression of This Molecule | [45] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Epigallocatechin gallate NP Info | + | Leptomycin B Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 40 Up-regulating the Expression of This Molecule | [46] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Sulforaphane NP Info | + | Clofarabine Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 41 Up-regulating the Expression of This Molecule | [47] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Epigallocatechin gallate NP Info | + | Vorinostat Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 42 Up-regulating the Expression of This Molecule | [48] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Silibinin NP Info | + | Vorinostat Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 43 Up-regulating the Expression of This Molecule | [49] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Genistein NP Info | + | Selenite Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 44 Up-regulating the Expression of This Molecule | [50] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Noscapine NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 45 Up-regulating the Expression of This Molecule | [51] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Tretinoin NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 46 Up-regulating the Expression of This Molecule | [52] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Capsaicin NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 47 Up-regulating the Expression of This Molecule | [53] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Sulforaphane NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 48 Up-regulating the Expression of This Molecule | [54] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Curcumin NP Info | + | Tamoxifen Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 49 Up-regulating the Expression of This Molecule | [55] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Gingerol NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 50 Up-regulating the Expression of This Molecule | [56] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Arsenic trioxide NP Info | + | Cotylenin A Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 51 Up-regulating the Expression of This Molecule | [57] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Capsaicin NP Info | + | 3,3'-diindolylmethane Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 52 Up-regulating the Expression of This Molecule | ||||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Curcumin NP Info | + | doxorubicin Drug Info | |
| Drug Combination 53 Up-regulating the Expression of This Molecule | [10] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Curcumin NP Info | + | Doxorubicin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 54 Up-regulating the Expression of This Molecule | [58] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Licochalcone A NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 55 Up-regulating the Expression of This Molecule | [59] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Ursolic acid NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 56 Up-regulating the Expression of This Molecule | [48] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Silibinin NP Info | + | Trichostatin A Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 57 Up-regulating the Expression of This Molecule | [60] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Luteolin NP Info | + | Lapatinib Drug Info | |
| Structure |
|
+ |
|
|
| Natural Product(s) of This Target | ||||
|---|---|---|---|---|
| 1 | Oridonin | NP Info | Investigative | Isodon rubescens |