Molecule Details
General Information of the Molecule | ||||
---|---|---|---|---|
Name |
DNA-binding factor KBF1 (p105)
|
|||
Synonyms |
Nuclear factor of kappa light polypeptide gene enhancer in Bcells 1; Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1; Nuclear factor NFkappaB p50 subunit; Nuclear factor NFkappaB p105 subunit; Nuclear factor NF-kappa-B p105 subunit; EBP1; EBP-1; DNAbinding factor KBF1
|
|||
Gene Name |
NFKB1
|
|||
Gene ID | ||||
Sequence |
MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYV
CEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCED GICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQA EGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDF SPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQ RKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFH PGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGE VTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQD ENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVED LLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAMM SNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGT TPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMAT SWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLG LGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQ AHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQ EGPLEGKI Click to Show/Hide
|
|||
Function |
NF-kappa-B is a pleiotropic transcription factor present in almost all cell types and is the endpoint of a series of signal transduction events that are initiated by a vast array of stimuli related to many biological processes such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. NF-kappa-B is a homo- or heterodimeric complex formed by the Rel-like domain-containing proteins RELA/p65, RELB, NFKB1/p105, NFKB1/p50, REL and NFKB2/p52 and the heterodimeric p65-p50 complex appears to be most abundant one. The dimers bind at kappa-B sites in the DNA of their target genes and the individual dimers have distinct preferences for different kappa-B sites that they can bind with distinguishable affinity and specificity. Different dimer combinations act as transcriptional activators or repressors, respectively. NF-kappa-B is controlled by various mechanisms of post-translational modification and subcellular compartmentalization as well as by interactions with other cofactors or corepressors. NF-kappa-B complexes are held in the cytoplasm in an inactive state complexed with members of the NF-kappa-B inhibitor (I-kappa-B) family. In a conventional activation pathway, I-kappa-B is phosphorylated by I-kappa-B kinases (IKKs) in response to different activators, subsequently degraded thus liberating the active NF-kappa-B complex which translocates to the nucleus. NF-kappa-B heterodimeric p65-p50 and RelB-p50 complexes are transcriptional activators. The NF-kappa-B p50-p50 homodimer is a transcriptional repressor, but can act as a transcriptional activator when associated with BCL3. NFKB1 appears to have dual functions such as cytoplasmic retention of attached NF-kappa-B proteins by p105 and generation of p50 by a cotranslational processing. The proteasome-mediated process ensures the production of both p50 and p105 and preserves their independent function, although processing of NFKB1/p105 also appears to occur post-translationally. p50 binds to the kappa-B consensus sequence 5'-GGRNNYYCC-3', located in the enhancer region of genes involved in immune response and acute phase reactions. In a complex with MAP3K8, NFKB1/p105 represses MAP3K8-induced MAPK signaling; active MAP3K8 is released by proteasome-dependent degradation of NFKB1/p105.
Click to Show/Hide
|
|||
Uniprot ID | ||||
Pfam | ||||
KEGG ID | ||||
TTD ID |
A List of Drug Combination(s) Able to Regulate This Molecule | ||||
---|---|---|---|---|
Activity Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Down-regulation | Click to Show/Hide | |||
Drug Combination 1 Down-regulating the Activity of This Molecule | [1] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Drug Combination 2 Down-regulating the Activity of This Molecule | [2] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Phenethyl isothiocyanate NP Info | + | Dibenzoylmethane Drug Info | |
Structure | + | |||
Drug Combination 3 Down-regulating the Activity of This Molecule | [3] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Ursolic acid NP Info | + | Gemcitabine Drug Info | |
Structure | + | |||
Drug Combination 4 Down-regulating the Activity of This Molecule | [4] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Wogonin NP Info | + | Tumor necrosis factor alpha Drug Info | |
Structure | + | |||
Drug Combination 5 Down-regulating the Activity of This Molecule | [5] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | Gemcitabine Drug Info | |
Structure | + | |||
Drug Combination 6 Down-regulating the Activity of This Molecule | [6] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Shikonin NP Info | + | Gemcitabine Drug Info | |
Structure | + | |||
Drug Combination 7 Down-regulating the Activity of This Molecule | [7] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 8 Down-regulating the Activity of This Molecule | [8] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Triptolide NP Info | + | Sorafenib Drug Info | |
Structure | + | |||
Drug Combination 9 Down-regulating the Activity of This Molecule | [9] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | Bacillus Calmette-Guerin Drug Info | |
Structure | + | |||
Drug Combination 10 Down-regulating the Activity of This Molecule | [1] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | Doxorubicin Drug Info | |
Structure | + | |||
Up-regulation | Click to Show/Hide | |||
Drug Combination 1 Up-regulating the Activity of This Molecule | [82] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Parthenolide NP Info | + | Balsalazide Drug Info | |
Structure | + | |||
Drug Combination 2 Up-regulating the Activity of This Molecule | [83] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Epigallocatechin gallate NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Down-regulation | Click to Show/Hide | |||
Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Drug Combination 2 Down-regulating the Expression of This Molecule | [10] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Genistein NP Info | + | N-(4-hydroxyphenyl) retinamide Drug Info | |
Structure | + | |||
Drug Combination 3 Down-regulating the Expression of This Molecule | [11] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | Carfilzomib Drug Info | |
Structure | + | |||
Drug Combination 4 Down-regulating the Expression of This Molecule | [12] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Wogonin NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Drug Combination 5 Down-regulating the Expression of This Molecule | [13] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Polydatin NP Info | + | N-palmitoylethanolamine Drug Info | |
Structure | + | |||
Drug Combination 6 Down-regulating the Expression of This Molecule | [14] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Quercetin NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Drug Combination 7 Down-regulating the Expression of This Molecule | [15] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Triptolide NP Info | + | Vasostatin Drug Info | |
Structure | + | |||
Drug Combination 8 Down-regulating the Expression of This Molecule | [16] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Resveratrol NP Info | + | Doxorubicin Drug Info | |
Structure | + | |||
Drug Combination 9 Down-regulating the Expression of This Molecule | [17] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Thymoquinone NP Info | + | Bortezomib Drug Info | |
Structure | + | |||
Drug Combination 10 Down-regulating the Expression of This Molecule | [18] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | Celecoxib Drug Info | |
Structure | + | |||
Drug Combination 11 Down-regulating the Expression of This Molecule | [19] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Genistein NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 12 Down-regulating the Expression of This Molecule | [20] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Apigenin NP Info | + | Gemcitabine Drug Info | |
Structure | + | |||
Drug Combination 13 Down-regulating the Expression of This Molecule | [21] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Genistein NP Info | + | Gemcitabine Drug Info | |
Structure | + | |||
Drug Combination 14 Down-regulating the Expression of This Molecule | [22] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Triptolide NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Drug Combination 15 Down-regulating the Expression of This Molecule | [23] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Triptolide NP Info | + | Tumor necrosis factor alpha Drug Info | |
Structure | + | |||
Drug Combination 16 Down-regulating the Expression of This Molecule | [24] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Gambogic acid NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 17 Down-regulating the Expression of This Molecule | [25] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | Mitomycin C Drug Info | |
Structure | + | |||
Drug Combination 18 Down-regulating the Expression of This Molecule | [26] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Oxymatrine NP Info | + | Sodium ferulate Drug Info | |
Structure | + | |||
Drug Combination 19 Down-regulating the Expression of This Molecule | [27] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | Capecitabine Drug Info | |
Structure | + | |||
Drug Combination 20 Down-regulating the Expression of This Molecule | [28] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Magnolol NP Info | + | Oxaliplatin Drug Info | |
Structure | + | |||
Drug Combination 21 Down-regulating the Expression of This Molecule | [29] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Epigallocatechin gallate NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 22 Down-regulating the Expression of This Molecule | [30] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Sulforaphane NP Info | + | Doxorubicin Drug Info | |
Structure | + | |||
Drug Combination 23 Down-regulating the Expression of This Molecule | [31] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Diosmin NP Info | + | Dactolisib Drug Info | |
Structure | + | |||
Drug Combination 24 Down-regulating the Expression of This Molecule | [32] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Vincamine | + | Tamoxifen + Zafirlukast | |
Click to Show/Hide the Each NP or Drug Structure of This Combination | ||||
Vincamine NP Info | Drug Info | |||
Drug Info | ||||
Drug Combination 25 Down-regulating the Expression of This Molecule | [33] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Arsenic trioxide NP Info | + | Bortezomib Drug Info | |
Structure | + | |||
Drug Combination 26 Down-regulating the Expression of This Molecule | [34] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Genistein NP Info | + | HA14-1 Drug Info | |
Structure | + | |||
Drug Combination 27 Down-regulating the Expression of This Molecule | [35] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | Sorafenib Drug Info | |
Structure | + | |||
Drug Combination 28 Down-regulating the Expression of This Molecule | [36] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Apigenin NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 29 Down-regulating the Expression of This Molecule | [37] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Cardamonin NP Info | + | Doxorubicin Drug Info | |
Structure | + | |||
Drug Combination 30 Down-regulating the Expression of This Molecule | [38] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Genistein NP Info | + | Centchroman Drug Info | |
Structure | + | |||
Drug Combination 31 Down-regulating the Expression of This Molecule | [39] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Sulforaphane NP Info | + | Sorafenib Drug Info | |
Structure | + | |||
Drug Combination 32 Down-regulating the Expression of This Molecule | [40] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Brucine NP Info | + | Gemcitabine Drug Info | |
Structure | + | |||
Drug Combination 33 Down-regulating the Expression of This Molecule | [41] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Asiatic acid NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 34 Down-regulating the Expression of This Molecule | [42] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Resveratrol NP Info | + | Gemcitabine Drug Info | |
Structure | + | |||
Drug Combination 35 Down-regulating the Expression of This Molecule | [43] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Epigallocatechin gallate NP Info | + | Interferon alpha-2b Drug Info | |
Structure | + | |||
Drug Combination 36 Down-regulating the Expression of This Molecule | [44] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Sulforaphane NP Info | + | Temozolomide Drug Info | |
Structure | + | |||
Drug Combination 37 Down-regulating the Expression of This Molecule | [45] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Thymoquinone NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 38 Down-regulating the Expression of This Molecule | [46] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Lactoferrin NP Info | + | Cephalosporin Drug Info | |
Structure | + | |||
Drug Combination 39 Down-regulating the Expression of This Molecule | [47] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Celastrol NP Info | + | Bortezomib Drug Info | |
Structure | + | |||
Drug Combination 40 Down-regulating the Expression of This Molecule | [48] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | Tolfenamic acid Drug Info | |
Structure | + | |||
Drug Combination 41 Down-regulating the Expression of This Molecule | [49] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | Carboplatin Drug Info | |
Structure | + | |||
Drug Combination 42 Down-regulating the Expression of This Molecule | [50] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Epigallocatechin gallate NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 43 Down-regulating the Expression of This Molecule | [51] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Citral NP Info | + | Pirarubicin Drug Info | |
Structure | + | |||
Drug Combination 44 Down-regulating the Expression of This Molecule | [52] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Flavopiridol NP Info | + | Bortezomib Drug Info | |
Structure | + | |||
Drug Combination 45 Down-regulating the Expression of This Molecule | [53] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Apigenin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 46 Down-regulating the Expression of This Molecule | [7] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 47 Down-regulating the Expression of This Molecule | [54] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Ursolic acid NP Info | + | Capecitabine Drug Info | |
Structure | + | |||
Drug Combination 48 Down-regulating the Expression of This Molecule | [55] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Vitexin NP Info | + | Doxorubicin Drug Info | |
Structure | + | |||
Drug Combination 49 Down-regulating the Expression of This Molecule | [56] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Mangiferin NP Info | + | Oxaliplatin Drug Info | |
Structure | + | |||
Drug Combination 50 Down-regulating the Expression of This Molecule | [57] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Epigallocatechin gallate NP Info | + | Vorinostat Drug Info | |
Structure | + | |||
Drug Combination 51 Down-regulating the Expression of This Molecule | [58] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Thymoquinone NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Drug Combination 52 Down-regulating the Expression of This Molecule | [59] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Delphinidin NP Info | + | Arsenite Drug Info | |
Structure | + | |||
Drug Combination 53 Down-regulating the Expression of This Molecule | [60] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Sulforaphane NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 54 Down-regulating the Expression of This Molecule | [61] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Oridonin NP Info | + | Cetuximab Drug Info | |
Structure | + | |||
Drug Combination 55 Down-regulating the Expression of This Molecule | [62] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Galangin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 56 Down-regulating the Expression of This Molecule | [63] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Tretinoin NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 57 Down-regulating the Expression of This Molecule | [64] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Emodin NP Info | + | Gemcitabine Drug Info | |
Structure | + | |||
Drug Combination 58 Down-regulating the Expression of This Molecule | [65] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Epigallocatechin gallate NP Info | + | Erlotinib Drug Info | |
Structure | + | |||
Drug Combination 59 Down-regulating the Expression of This Molecule | [66] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Flavopiridol NP Info | + | Tumor necrosis factor alpha Drug Info | |
Structure | + | |||
Drug Combination 60 Down-regulating the Expression of This Molecule | [67] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Luteolin NP Info | + | Gemcitabine Drug Info | |
Structure | + | |||
Drug Combination 61 Down-regulating the Expression of This Molecule | [68] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Cardamonin NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Drug Combination 62 Down-regulating the Expression of This Molecule | [69] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Lycopene NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 63 Down-regulating the Expression of This Molecule | [70] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Ursolic acid NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 64 Down-regulating the Expression of This Molecule | [71] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Sulforaphane NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Drug Combination 65 Down-regulating the Expression of This Molecule | [72] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Wogonoside NP Info | + | Dextran sulfate sodium Drug Info | |
Structure | + | |||
Drug Combination 66 Down-regulating the Expression of This Molecule | [73] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Garcinol NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Up-regulation | Click to Show/Hide | |||
Drug Combination 1 Up-regulating the Expression of This Molecule | [84] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Astilbin NP Info | + | Methotrexate Drug Info | |
Structure | + | |||
Drug Combination 2 Up-regulating the Expression of This Molecule | [85] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Miltefosine NP Info | + | Paromomycin Drug Info | |
Structure | + | |||
Drug Combination 3 Up-regulating the Expression of This Molecule | [86] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Gambogic acid NP Info | + | Doxorubicin Drug Info | |
Structure | + | |||
Drug Combination 4 Up-regulating the Expression of This Molecule | [24] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Gambogic acid NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 5 Up-regulating the Expression of This Molecule | [87] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Thymoquinone NP Info | + | Doxorubicin Drug Info | |
Structure | + | |||
Drug Combination 6 Up-regulating the Expression of This Molecule | [88] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Celastrol NP Info | + | Temozolomide Drug Info | |
Structure | + | |||
Drug Combination 7 Up-regulating the Expression of This Molecule | [89] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Taxifolin NP Info | + | Dapagliflozin Drug Info | |
Structure | + | |||
Drug Combination 8 Up-regulating the Expression of This Molecule | [90] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Epigallocatechin gallate NP Info | + | Sodium butyrate Drug Info | |
Structure | + | |||
Drug Combination 9 Up-regulating the Expression of This Molecule | [91] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Arsenic trioxide NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 10 Up-regulating the Expression of This Molecule | [92] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Celastrol NP Info | + | Vorinostat Drug Info | |
Structure | + | |||
Drug Combination 11 Up-regulating the Expression of This Molecule | [93] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Capsaicin NP Info | + | 3,3'-diindolylmethane Drug Info | |
Structure | + | |||
Phosphorylation Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Down-regulation | Click to Show/Hide | |||
Drug Combination 1 Down-regulating the Phosphorylation of This Molecule | [74] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | 1-deoxynojirimycin NP Info | + | Indomethacin Drug Info | |
Structure | + | |||
Drug Combination 2 Down-regulating the Phosphorylation of This Molecule | [75] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Dicoumarol NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 3 Down-regulating the Phosphorylation of This Molecule | [76] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Resveratrol NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Drug Combination 4 Down-regulating the Phosphorylation of This Molecule | [77] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Gamma tocotrienol + Vitamin E | + | Celecoxib | |
Click to Show/Hide the Each NP or Drug Structure of This Combination | ||||
Gamma tocotrienol NP Info | Drug Info | |||
Vitamin E NP Info | ||||
Drug Combination 5 Down-regulating the Phosphorylation of This Molecule | [7] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 6 Down-regulating the Phosphorylation of This Molecule | [78] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Eugenol NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 7 Down-regulating the Phosphorylation of This Molecule | [79] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Acovenoside A NP Info | + | Doxorubicin Drug Info | |
Structure | + | |||
Drug Combination 8 Down-regulating the Phosphorylation of This Molecule | [80] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Resveratrol NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 9 Down-regulating the Phosphorylation of This Molecule | [81] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Triptolide NP Info | + | BIIB021 Drug Info | |
Structure | + |
Natural Product(s) of This Target | ||||
---|---|---|---|---|
1 | 6-shogaol | NP Info | Investigative | Acacia confusa |
2 | Cardamonin | NP Info | Investigative | Alpinia zerumbet |
3 | Cryptotanshinone | NP Info | Investigative | Salvia miltiorrhiza |
4 | Cucurbitacin D | NP Info | Investigative | Cucurbitaceae |
5 | Fucoxanthin | NP Info | Phase 2 | Saccharina japonica |
6 | Lycopene | NP Info | Phase 2 | Daucus carota |
7 | Oridonin | NP Info | Investigative | Isodon rubescens |
8 | Procyanidin | NP Info | Phase 2 | Cinnamomum camphora |
9 | Salvianolic acid A | NP Info | Investigative | Salvia |
Drug(s) of This Target | ||||
---|---|---|---|---|
1 | Pyrroloquinoline quinone | Drug Info | Investigative | Osteoporosis |
2 | Tolfenamic acid | Drug Info | Investigative | Pancreatic cancer |