Skip to main content
  •   Home
  • 2026 Update 
    • Search for Activity
    • 2026 update
    • Search for Structure
    • 2026 update
  •   Download
  •   Manual

Molecule Details

General Information of the Molecule
Name
DNA-binding factor KBF1 (p105)
Synonyms
Nuclear factor of kappa light polypeptide gene enhancer in Bcells 1; Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1; Nuclear factor NFkappaB p50 subunit; Nuclear factor NFkappaB p105 subunit; Nuclear factor NF-kappa-B p105 subunit; EBP1; EBP-1; DNAbinding factor KBF1
Gene Name
NFKB1
Gene ID
4790
Sequence
MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYV
CEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCED
GICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQA
EGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY
DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDF
SPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQ
RKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFH
PGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGE
VTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQD
ENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVED
LLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAMM
SNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGT
TPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMAT
SWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLG
LGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQ
AHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQ
EGPLEGKI
    Click to Show/Hide
Function
NF-kappa-B is a pleiotropic transcription factor present in almost all cell types and is the endpoint of a series of signal transduction events that are initiated by a vast array of stimuli related to many biological processes such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. NF-kappa-B is a homo- or heterodimeric complex formed by the Rel-like domain-containing proteins RELA/p65, RELB, NFKB1/p105, NFKB1/p50, REL and NFKB2/p52 and the heterodimeric p65-p50 complex appears to be most abundant one. The dimers bind at kappa-B sites in the DNA of their target genes and the individual dimers have distinct preferences for different kappa-B sites that they can bind with distinguishable affinity and specificity. Different dimer combinations act as transcriptional activators or repressors, respectively. NF-kappa-B is controlled by various mechanisms of post-translational modification and subcellular compartmentalization as well as by interactions with other cofactors or corepressors. NF-kappa-B complexes are held in the cytoplasm in an inactive state complexed with members of the NF-kappa-B inhibitor (I-kappa-B) family. In a conventional activation pathway, I-kappa-B is phosphorylated by I-kappa-B kinases (IKKs) in response to different activators, subsequently degraded thus liberating the active NF-kappa-B complex which translocates to the nucleus. NF-kappa-B heterodimeric p65-p50 and RelB-p50 complexes are transcriptional activators. The NF-kappa-B p50-p50 homodimer is a transcriptional repressor, but can act as a transcriptional activator when associated with BCL3. NFKB1 appears to have dual functions such as cytoplasmic retention of attached NF-kappa-B proteins by p105 and generation of p50 by a cotranslational processing. The proteasome-mediated process ensures the production of both p50 and p105 and preserves their independent function, although processing of NFKB1/p105 also appears to occur post-translationally. p50 binds to the kappa-B consensus sequence 5'-GGRNNYYCC-3', located in the enhancer region of genes involved in immune response and acute phase reactions. In a complex with MAP3K8, NFKB1/p105 represses MAP3K8-induced MAPK signaling; active MAP3K8 is released by proteasome-dependent degradation of NFKB1/p105.
    Click to Show/Hide
Uniprot ID
NFKB1_HUMAN
Pfam
PF12796 ; PF00531 ; PF16179 ; PF00554
KEGG ID
hsa4790
TTD ID
T40192
A List of Drug Combination(s) Able to Regulate This Molecule
          Activity Regulation     Click to Show/Hide the Drug Combination Regulating This Molecule
                 Down-regulation     Click to Show/Hide
                    Drug Combination 1 Down-regulating the Activity of This Molecule [1]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 2 Down-regulating the Activity of This Molecule [2]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Phenethyl isothiocyanate   NP Info  + Dibenzoylmethane   Drug Info 
                    Structure +
                    Drug Combination 3 Down-regulating the Activity of This Molecule [3]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Ursolic acid   NP Info  + Gemcitabine   Drug Info 
                    Structure +
                    Drug Combination 4 Down-regulating the Activity of This Molecule [4]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Wogonin   NP Info  + Tumor necrosis factor alpha   Drug Info 
                    Structure +
                    Drug Combination 5 Down-regulating the Activity of This Molecule [5]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + Gemcitabine   Drug Info 
                    Structure +
                    Drug Combination 6 Down-regulating the Activity of This Molecule [6]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Shikonin   NP Info  + Gemcitabine   Drug Info 
                    Structure +
                    Drug Combination 7 Down-regulating the Activity of This Molecule [7]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + TNF-related apoptosis inducing ligand    Drug Info 
                    Structure +
                    Drug Combination 8 Down-regulating the Activity of This Molecule [8]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Triptolide   NP Info  + Sorafenib   Drug Info 
                    Structure +
                    Drug Combination 9 Down-regulating the Activity of This Molecule [9]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + Bacillus Calmette-Guerin   Drug Info 
                    Structure +
                    Drug Combination 10 Down-regulating the Activity of This Molecule
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + doxorubicin   Drug Info 
                    Drug Combination 11 Down-regulating the Activity of This Molecule [1]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + Doxorubicin   Drug Info 
                    Structure +
                 Up-regulation     Click to Show/Hide
                    Drug Combination 1 Up-regulating the Activity of This Molecule [82]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Parthenolide   NP Info  + Balsalazide   Drug Info 
                    Structure +
                    Drug Combination 2 Up-regulating the Activity of This Molecule [83]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Epigallocatechin gallate   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
          Expression Regulation     Click to Show/Hide the Drug Combination Regulating This Molecule
                 Down-regulation     Click to Show/Hide
                    Drug Combination 1 Down-regulating the Expression of This Molecule [1]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 2 Down-regulating the Expression of This Molecule [10]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Genistein   NP Info  + N-(4-hydroxyphenyl) retinamide   Drug Info 
                    Structure +
                    Drug Combination 3 Down-regulating the Expression of This Molecule [11]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + Carfilzomib   Drug Info 
                    Structure +
                    Drug Combination 4 Down-regulating the Expression of This Molecule [12]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Wogonin   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 5 Down-regulating the Expression of This Molecule [13]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Polydatin   NP Info  + N-palmitoylethanolamine   Drug Info 
                    Structure +
                    Drug Combination 6 Down-regulating the Expression of This Molecule [14]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Quercetin   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 7 Down-regulating the Expression of This Molecule [15]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Triptolide   NP Info  + Vasostatin   Drug Info 
                    Structure +
                    Drug Combination 8 Down-regulating the Expression of This Molecule
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Resveratrol   NP Info  + Doxorubicin   Drug Info 
                    Drug Combination 9 Down-regulating the Expression of This Molecule [16]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Resveratrol   NP Info  + Doxorubicin   Drug Info 
                    Structure +
                    Drug Combination 10 Down-regulating the Expression of This Molecule [17]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Thymoquinone   NP Info  + Bortezomib   Drug Info 
                    Structure +
                    Drug Combination 11 Down-regulating the Expression of This Molecule [18]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + Celecoxib   Drug Info 
                    Structure +
                    Drug Combination 12 Down-regulating the Expression of This Molecule [19]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Genistein   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 13 Down-regulating the Expression of This Molecule [20]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Apigenin   NP Info  + Gemcitabine   Drug Info 
                    Structure +
                    Drug Combination 14 Down-regulating the Expression of This Molecule [21]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Genistein   NP Info  + Gemcitabine   Drug Info 
                    Structure +
                    Drug Combination 15 Down-regulating the Expression of This Molecule [22]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Triptolide   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 16 Down-regulating the Expression of This Molecule [23]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Triptolide   NP Info  + Tumor necrosis factor alpha   Drug Info 
                    Structure +
                    Drug Combination 17 Down-regulating the Expression of This Molecule [24]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Gambogic acid   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 18 Down-regulating the Expression of This Molecule [25]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + Mitomycin C   Drug Info 
                    Structure +
                    Drug Combination 19 Down-regulating the Expression of This Molecule [26]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Oxymatrine   NP Info  + Sodium ferulate   Drug Info 
                    Structure +
                    Drug Combination 20 Down-regulating the Expression of This Molecule [27]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + Capecitabine   Drug Info 
                    Structure +
                    Drug Combination 21 Down-regulating the Expression of This Molecule [28]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Magnolol   NP Info  + Oxaliplatin   Drug Info 
                    Structure +
                    Drug Combination 22 Down-regulating the Expression of This Molecule [29]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Epigallocatechin gallate   NP Info  + TNF-related apoptosis inducing ligand    Drug Info 
                    Structure +
                    Drug Combination 23 Down-regulating the Expression of This Molecule [30]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Sulforaphane   NP Info  + Doxorubicin   Drug Info 
                    Structure +
                    Drug Combination 24 Down-regulating the Expression of This Molecule [31]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Diosmin   NP Info  + Dactolisib   Drug Info 
                    Structure +
                    Drug Combination 25 Down-regulating the Expression of This Molecule [32]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Vincamine + Tamoxifen + Zafirlukast
    Click to Show/Hide the Each NP or Drug Structure of This Combination
Vincamine   NP Info     Drug Info 
   Drug Info 
                    Drug Combination 26 Down-regulating the Expression of This Molecule [33]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + Bortezomib   Drug Info 
                    Structure +
                    Drug Combination 27 Down-regulating the Expression of This Molecule [34]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Genistein   NP Info  + HA14-1   Drug Info 
                    Structure +
                    Drug Combination 28 Down-regulating the Expression of This Molecule [35]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + Sorafenib   Drug Info 
                    Structure +
                    Drug Combination 29 Down-regulating the Expression of This Molecule [36]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Apigenin   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 30 Down-regulating the Expression of This Molecule [37]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Cardamonin   NP Info  + Doxorubicin   Drug Info 
                    Structure +
                    Drug Combination 31 Down-regulating the Expression of This Molecule [38]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Genistein   NP Info  + Centchroman   Drug Info 
                    Structure +
                    Drug Combination 32 Down-regulating the Expression of This Molecule [39]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Sulforaphane   NP Info  + Sorafenib   Drug Info 
                    Structure +
                    Drug Combination 33 Down-regulating the Expression of This Molecule [40]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Brucine   NP Info  + Gemcitabine   Drug Info 
                    Structure +
                    Drug Combination 34 Down-regulating the Expression of This Molecule [41]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Asiatic acid   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 35 Down-regulating the Expression of This Molecule [42]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Resveratrol   NP Info  + Gemcitabine   Drug Info 
                    Structure +
                    Drug Combination 36 Down-regulating the Expression of This Molecule [43]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Epigallocatechin gallate   NP Info  + Interferon alpha-2b   Drug Info 
                    Structure +
                    Drug Combination 37 Down-regulating the Expression of This Molecule [44]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Sulforaphane   NP Info  + Temozolomide   Drug Info 
                    Structure +
                    Drug Combination 38 Down-regulating the Expression of This Molecule [45]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Thymoquinone   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 39 Down-regulating the Expression of This Molecule [46]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Lactoferrin   NP Info  + Cephalosporin   Drug Info 
                    Structure +
                    Drug Combination 40 Down-regulating the Expression of This Molecule [47]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Celastrol   NP Info  + Bortezomib   Drug Info 
                    Structure +
                    Drug Combination 41 Down-regulating the Expression of This Molecule [48]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + Tolfenamic acid   Drug Info 
                    Structure +
                    Drug Combination 42 Down-regulating the Expression of This Molecule [49]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + Carboplatin   Drug Info 
                    Structure +
                    Drug Combination 43 Down-regulating the Expression of This Molecule [50]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Epigallocatechin gallate   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 44 Down-regulating the Expression of This Molecule [51]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Citral   NP Info  + Pirarubicin   Drug Info 
                    Structure +
                    Drug Combination 45 Down-regulating the Expression of This Molecule [52]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Flavopiridol   NP Info  + Bortezomib   Drug Info 
                    Structure +
                    Drug Combination 46 Down-regulating the Expression of This Molecule [53]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Apigenin   NP Info  + TNF-related apoptosis inducing ligand    Drug Info 
                    Structure +
                    Drug Combination 47 Down-regulating the Expression of This Molecule [7]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + TNF-related apoptosis inducing ligand    Drug Info 
                    Structure +
                    Drug Combination 48 Down-regulating the Expression of This Molecule [54]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Ursolic acid   NP Info  + Capecitabine   Drug Info 
                    Structure +
                    Drug Combination 49 Down-regulating the Expression of This Molecule [55]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Vitexin   NP Info  + Doxorubicin   Drug Info 
                    Structure +
                    Drug Combination 50 Down-regulating the Expression of This Molecule [56]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Mangiferin   NP Info  + Oxaliplatin   Drug Info 
                    Structure +
                    Drug Combination 51 Down-regulating the Expression of This Molecule [57]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Epigallocatechin gallate   NP Info  + Vorinostat   Drug Info 
                    Structure +
                    Drug Combination 52 Down-regulating the Expression of This Molecule [58]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Thymoquinone   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 53 Down-regulating the Expression of This Molecule [59]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Delphinidin   NP Info  + Arsenite   Drug Info 
                    Structure +
                    Drug Combination 54 Down-regulating the Expression of This Molecule [60]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Sulforaphane   NP Info  + TNF-related apoptosis inducing ligand    Drug Info 
                    Structure +
                    Drug Combination 55 Down-regulating the Expression of This Molecule [61]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Oridonin   NP Info  + Cetuximab   Drug Info 
                    Structure +
                    Drug Combination 56 Down-regulating the Expression of This Molecule [62]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Galangin   NP Info  + TNF-related apoptosis inducing ligand    Drug Info 
                    Structure +
                    Drug Combination 57 Down-regulating the Expression of This Molecule [63]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Tretinoin   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 58 Down-regulating the Expression of This Molecule [64]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Emodin   NP Info  + Gemcitabine   Drug Info 
                    Structure +
                    Drug Combination 59 Down-regulating the Expression of This Molecule [65]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Epigallocatechin gallate   NP Info  + Erlotinib   Drug Info 
                    Structure +
                    Drug Combination 60 Down-regulating the Expression of This Molecule [66]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Flavopiridol   NP Info  + Tumor necrosis factor alpha   Drug Info 
                    Structure +
                    Drug Combination 61 Down-regulating the Expression of This Molecule [67]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Luteolin   NP Info  + Gemcitabine   Drug Info 
                    Structure +
                    Drug Combination 62 Down-regulating the Expression of This Molecule [68]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Cardamonin   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 63 Down-regulating the Expression of This Molecule [69]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Lycopene   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 64 Down-regulating the Expression of This Molecule [70]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Ursolic acid   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 65 Down-regulating the Expression of This Molecule [71]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Sulforaphane   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 66 Down-regulating the Expression of This Molecule [72]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Wogonoside   NP Info  + Dextran sulfate sodium   Drug Info 
                    Structure +
                    Drug Combination 67 Down-regulating the Expression of This Molecule [73]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Garcinol   NP Info  + Cisplatin   Drug Info 
                    Structure +
                 Up-regulation     Click to Show/Hide
                    Drug Combination 1 Up-regulating the Expression of This Molecule [84]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Astilbin   NP Info  + Methotrexate   Drug Info 
                    Structure +
                    Drug Combination 2 Up-regulating the Expression of This Molecule [85]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Miltefosine   NP Info  + Paromomycin   Drug Info 
                    Structure +
                    Drug Combination 3 Up-regulating the Expression of This Molecule [86]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Gambogic acid   NP Info  + Doxorubicin   Drug Info 
                    Structure +
                    Drug Combination 4 Up-regulating the Expression of This Molecule [24]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Gambogic acid   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 5 Up-regulating the Expression of This Molecule [87]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Thymoquinone   NP Info  + Doxorubicin   Drug Info 
                    Structure +
                    Drug Combination 6 Up-regulating the Expression of This Molecule [88]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Celastrol   NP Info  + Temozolomide   Drug Info 
                    Structure +
                    Drug Combination 7 Up-regulating the Expression of This Molecule [89]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Taxifolin   NP Info  + Dapagliflozin   Drug Info 
                    Structure +
                    Drug Combination 8 Up-regulating the Expression of This Molecule [90]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Epigallocatechin gallate   NP Info  + Sodium butyrate   Drug Info 
                    Structure +
                    Drug Combination 9 Up-regulating the Expression of This Molecule [91]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 10 Up-regulating the Expression of This Molecule [92]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Celastrol   NP Info  + Vorinostat   Drug Info 
                    Structure +
                    Drug Combination 11 Up-regulating the Expression of This Molecule [93]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Capsaicin   NP Info  + 3,3'-diindolylmethane   Drug Info 
                    Structure +
          Phosphorylation Regulation     Click to Show/Hide the Drug Combination Regulating This Molecule
                 Down-regulation     Click to Show/Hide
                    Drug Combination 1 Down-regulating the Phosphorylation of This Molecule [74]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name 1-deoxynojirimycin   NP Info  + Indomethacin   Drug Info 
                    Structure +
                    Drug Combination 2 Down-regulating the Phosphorylation of This Molecule [75]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Dicoumarol   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 3 Down-regulating the Phosphorylation of This Molecule [76]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Resveratrol   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 4 Down-regulating the Phosphorylation of This Molecule [77]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Gamma tocotrienol + Vitamin E + Celecoxib
    Click to Show/Hide the Each NP or Drug Structure of This Combination
Gamma tocotrienol   NP Info     Drug Info 
Vitamin E   NP Info 
                    Drug Combination 5 Down-regulating the Phosphorylation of This Molecule [7]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + TNF-related apoptosis inducing ligand    Drug Info 
                    Structure +
                    Drug Combination 6 Down-regulating the Phosphorylation of This Molecule [78]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Eugenol   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 7 Down-regulating the Phosphorylation of This Molecule [79]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Acovenoside A   NP Info  + Doxorubicin   Drug Info 
                    Structure +
                    Drug Combination 8 Down-regulating the Phosphorylation of This Molecule [80]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Resveratrol   NP Info  + TNF-related apoptosis inducing ligand    Drug Info 
                    Structure +
                    Drug Combination 9 Down-regulating the Phosphorylation of This Molecule [81]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Triptolide   NP Info  + BIIB021   Drug Info 
                    Structure +
Natural Product(s) of This Target
1 6-shogaol  NP Info  Investigative Acacia confusa
2 Cardamonin  NP Info  Investigative Alpinia zerumbet
3 Cryptotanshinone  NP Info  Investigative Salvia miltiorrhiza
4 Cucurbitacin D  NP Info  Investigative Cucurbitaceae
5 Fucoxanthin  NP Info  Phase 2 Saccharina japonica
6 Lycopene  NP Info  Phase 2 Daucus carota
7 Oridonin  NP Info  Investigative Isodon rubescens
8 Procyanidin  NP Info  Phase 2 Cinnamomum camphora
9 Salvianolic acid A  NP Info  Investigative Salvia
Drug(s) of This Target
1 Pyrroloquinoline quinone  Drug Info  Investigative Osteoporosis
2 Tolfenamic acid  Drug Info  Investigative Pancreatic cancer
References
Reference 1 Curcumin enhances cytotoxicity of chemotherapeutic agents in prostate cancer cells by inducing p21(WAF1/CIP1) and C/EBPbeta expressions and suppressing NF-kappaB activation. Prostate. 2002 May 15;51(3):211-8.
Reference 2 Phenethyl isothiocyanate in combination with dibenzoylmethane inhibits the androgen-independent growth of prostate cancer cells. Food Funct. 2018 Apr 25;9(4):2398-2408.
Reference 3 Ursolic acid inhibits the growth of human pancreatic cancer and enhances the antitumor potential of gemcitabine in an orthotopic mouse model through suppression of the inflammatory microenvironment. Oncotarget. 2016 Mar 15;7(11):13182-96.
Reference 4 Wogonin sensitizes resistant malignant cells to TNFalpha- and TRAIL-induced apoptosis. Blood. 2006 Dec 1;108(12):3700-6.
Reference 5 Curcumin potentiates antitumor activity of gemcitabine in an orthotopic model of pancreatic cancer through suppression of proliferation, angiogenesis, and inhibition of nuclear factor-kappaB-regulated gene products. Cancer Res. 2007 Apr 15;67(8):3853-61.
Reference 6 Shikonin suppresses tumor growth and synergizes with gemcitabine in a pancreatic cancer xenograft model: Involvement of NF-kappaB signaling pathway. Biochem Pharmacol. 2014 Apr 1;88(3):322-33.
Reference 7 Curcumin sensitizes tumor necrosis factor-related apoptosis-inducing ligand (TRAIL)-induced apoptosis through reactive oxygen species-mediated upregulation of death receptor 5 (DR5). Carcinogenesis. 2005 Nov;26(11):1905-13.
Reference 8 Sorafenib and triptolide as combination therapy for hepatocellular carcinoma. Surgery. 2014 Aug;156(2):270-9.
Reference 9 Curcumin potentiates the antitumor effects of Bacillus Calmette-Guerin against bladder cancer through the downregulation of NF-kappaB and upregulation of TRAIL receptors. Cancer Res. 2009 Dec 1;69(23):8958-66.
Reference 10 Combination of N-(4-hydroxyphenyl) retinamide and genistein increased apoptosis in neuroblastoma SK-N-BE2 and SH-SY5Y xenografts. Neuroscience. 2009 Sep 29;163(1):286-95.
Reference 11 Curcumin ameliorates the in vitro efficacy of carfilzomib in human multiple myeloma U266 cells targeting p53 and NF-kappaB pathways. Toxicol In Vitro. 2018 Mar;47:186-194.
Reference 12 Wogonin potentiates the antitumor effects of low dose 5-fluorouracil against gastric cancer through induction of apoptosis by down-regulation of NF-kappaB and regulation of its metabolism. Toxicol Lett. 2010 Sep 1;197(3):201-10.
Reference 13 Palmitoylethanolamide and Polydatin combination reduces inflammation and oxidative stress in vascular injury. Pharmacol Res. 2017 Sep;123:83-92.
Reference 14 Quercetin enhances 5-fluorouracil-induced apoptosis in MSI colorectal cancer cells through p53 modulation. Cancer Chemother Pharmacol. 2011 Dec;68(6):1449-57.
Reference 15 Herbal compound triptolide synergistically enhanced antitumor activity of vasostatin120-180. Anticancer Drugs. 2013 Oct;24(9):945-57.
Reference 16 Resveratrol enhances the cytotoxic profile of docetaxel and doxorubicin in solid tumour cell lines in vitro. Cell Prolif. 2011 Dec;44(6):591-601.
Reference 17 Thymoquinone overcomes chemoresistance and enhances the anticancer effects of bortezomib through abrogation of NF-KappaB regulated gene products in multiple myeloma xenograft mouse model. Oncotarget. 2014 Feb 15;5(3):634-48.
Reference 18 Celecoxib and curcumin synergistically inhibit the growth of colorectal cancer cells. Clin Cancer Res. 2005 Sep 15;11(18):6738-44.
Reference 19 Synergistic action of genistein and cisplatin on growth inhibition and cytotoxicity of human medulloblastoma cells. Pediatr Neurosurg. 2000 Sep;33(3):123-31.
Reference 20 Enhanced anti-tumor effect of combination therapy with gemcitabine and apigenin in pancreatic cancer. Cancer Lett. 2008 Jan 18;259(1):39-49.
Reference 21 Genistein potentiates the anti-cancer effects of gemcitabine in human osteosarcoma via the downregulation of Akt and nuclear factor-KappaB pathway. Anticancer Agents Med Chem. 2012 Jun;12(5):554-63.
Reference 22 Triptolide simultaneously induces reactive oxygen species, inhibits NF-kappaB activity and sensitizes 5-fluorouracil in colorectal cancer cell lines. Cancer Lett. 2010 May 28;291(2):200-8.
Reference 23 Synergistic cytotoxicity and apoptosis induced in human cholangiocarcinoma cell lines by a combined treatment with tumor necrosis factor-alpha (TNF-alpha) and triptolide. Asian Pac J Allergy Immunol. 2002 Sep;20(3):167-73.
Reference 24 Combination of gambogic acid with cisplatin enhances the antitumor effects on cisplatin-resistant lung cancer cells by downregulating MRP2 and LRP expression. Onco Targets Ther. 2016 Jun 2;9:3359-68.
Reference 25 Curcumin enhances the mitomycin C-induced cytotoxicity via downregulation of MKK1/2-ERK1/2-mediated Rad51 expression in non-small cell lung cancer cells. Toxicol Appl Pharmacol. 2011 Sep 15;255(3):327-38.
Reference 26 The Protective Effect of Sodium Ferulate and Oxymatrine Combination on Paraquat-induced Lung Injury. Iran J Pharm Res. Spring 2015;14(2):573-83.
Reference 27 Curcumin sensitizes human colorectal cancer to capecitabine by modulation of cyclin D1, COX-2, MMP-9, VEGF and CXCR4 expression in an orthotopic mouse model. Int J Cancer. 2009 Nov 1;125(9):2187-97.
Reference 28 Protective effect of magnolol on oxaliplatin-induced intestinal injury in mice. Phytother Res. 2019 Apr;33(4):1161-1172.
Reference 29 Green tea polyphenol EGCG sensitizes human prostate carcinoma LNCaP cells to TRAIL-mediated apoptosis and synergistically inhibits biomarkers associated with angiogenesis and metastasis. Oncogene. 2008 Mar 27;27(14):2055-63.
Reference 30 Sulforaphane increases the efficacy of doxorubicin in mouse fibroblasts characterized by p53 mutations. Mutat Res. 2006 Oct 10;601(1-2):92-101.
Reference 31 The synergistic anti-proliferative effect of the combination of diosmin and BEZ-235 (dactolisib) on the HCT-116 colorectal cancer cell line occurs through inhibition of the PI3K/Akt/mTOR/NF-kappaB axis. Mol Biol Rep. 2020 Mar;47(3):2217-2230.
Reference 32 Zafirlukast and vincamine ameliorate tamoxifen-induced oxidative stress and inflammation: Role of the JNK/ERK pathway. Life Sci. 2018 Jun 1;202:78-88.
Reference 33 Rationale and efficacy of proteasome inhibitor combined with arsenic trioxide in the treatment of acute promyelocytic leukemia. Leukemia. 2016 Nov;30(11):2169-2178.
Reference 34 Bcl-2 inhibitor HA14-1 and genistein together adeptly down regulated survival factors and activated cysteine proteases for apoptosis in human malignant neuroblastoma SK-N-BE2 and SH-SY5Y cells. Brain Res. 2009 Aug 4;1283:155-66.
Reference 35 Combinatorial anticancer effects of curcumin and sorafenib towards thyroid cancer cells via PI3K/Akt and ERK pathways. Nat Prod Res. 2016 Aug;30(16):1858-61.
Reference 36 Protective effects of apigenin and myricetin against cisplatin-induced nephrotoxicity in mice. Pharm Biol. 2017 Dec;55(1):766-774.
Reference 37 Cardamonin reduces chemotherapy-enriched breast cancer stem-like cells in vitro and in vivo. Oncotarget. 2016 Jan 5;7(1):771-85.
Reference 38 Genistein synergizes centchroman action in human breast cancer cells. Indian J Pharmacol. Nov-Dec 2016;48(6):637-642.
Reference 39 Synergistic activity of sorafenib and sulforaphane abolishes pancreatic cancer stem cell characteristics. Cancer Res. 2010 Jun 15;70(12):5004-13.
Reference 40 Anticancer effects of brucine and gemcitabine combination in MCF-7 human breast cancer cells. Nat Prod Res. 2015;29(5):484-90.
Reference 41 Asiatic acid protects against cisplatin-induced acute kidney injury via anti-apoptosis and anti-inflammation. Biomed Pharmacother. 2018 Nov;107:1354-1362.
Reference 42 Resveratrol, a multitargeted agent, can enhance antitumor activity of gemcitabine in vitro and in orthotopic mouse model of human pancreatic cancer. Int J Cancer. 2010 Jul 15;127(2):257-68.
Reference 43 (-)-Epigallocatechin-3-gallate (EGCG) sensitizes melanoma cells to interferon induced growth inhibition in a mouse model of human melanoma. Cell Cycle. 2009 Jul 1;8(13):2057-63.
Reference 44 Sulforaphane enhances temozolomide-induced apoptosis because of down-regulation of miR-21 via Wnt/Beta-catenin signaling in glioblastoma. J Neurochem. 2015 Sep;134(5):811-8.
Reference 45 Thymoquinone and cisplatin as a therapeutic combination in lung cancer: In vitro and in vivo. J Exp Clin Cancer Res. 2010 Jul 1;29(1):87.
Reference 46 Effect of combination therapy with lactoferrin and antibiotics against staphylococcal mastitis on drying cows. J Vet Med Sci. 2006 Mar;68(3):205-11.
Reference 47 Celastrol Attenuates the Invasion and Migration and Augments the Anticancer Effects of Bortezomib in a Xenograft Mouse Model of Multiple Myeloma. Front Pharmacol. 2018 May 3;9:365.
Reference 48 Combination of tolfenamic acid and curcumin induces colon cancer cell growth inhibition through modulating specific transcription factors and reactive oxygen species. Oncotarget. 2016 Jan 19;7(3):3186-200.
Reference 49 Curcumin sensitizes human lung cancer cells to apoptosis and metastasis synergistically combined with carboplatin. Exp Biol Med (Maywood). 2015 Nov;240(11):1416-25.
Reference 50 Reversal of Cisplatin resistance by epigallocatechin gallate is mediated by downregulation of axl and tyro 3 expression in human lung cancer cells. Korean J Physiol Pharmacol. 2014 Feb;18(1):61-6.
Reference 51 Combination Treatment of Citral Potentiates the Efficacy of Hyperthermic Intraperitoneal Chemoperfusion with Pirarubicin for Colorectal Cancer. Mol Pharm. 2017 Oct 2;14(10):3588-3597.
Reference 52 Bortezomib and flavopiridol interact synergistically to induce apoptosis in chronic myeloid leukemia cells resistant to imatinib mesylate through both Bcr/Abl-dependent and -independent mechanisms. Blood. 2004 Jul 15;104(2):509-18.
Reference 53 Ethanolic Extract of Propolis Augments TRAIL-Induced Apoptotic Death in Prostate Cancer Cells. Evid Based Complement Alternat Med. 2011;2011:535172.
Reference 54 Ursolic acid inhibits growth and metastasis of human colorectal cancer in an orthotopic nude mouse model by targeting multiple cell signaling pathways: chemosensitization with capecitabine. Clin Cancer Res. 2012 Sep 15;18(18):4942-53.
Reference 55 Vitexin attenuates acute doxorubicin cardiotoxicity in rats via the suppression of oxidative stress, inflammation and apoptosis and the activation of FOXO3a. Exp Ther Med. 2016 Sep;12(3):1879-1884.
Reference 56 Combination treatment with oxaliplatin and mangiferin causes increased apoptosis and downregulation of NFKappaB in cancer cell lines. Afr J Tradit Complement Altern Med. 2011;8(2):177-84.
Reference 57 Anti-melanoma effects of vorinostat in combination with polyphenolic antioxidant (-)-epigallocatechin-3-gallate (EGCG). Pharm Res. 2010 Jun;27(6):1103-14.
Reference 58 Thymoquinone subdues tumor growth and potentiates the chemopreventive effect of 5-fluorouracil on the early stages of colorectal carcinogenesis in rats. Drug Des Devel Ther. 2016 Jul 11;10:2239-53.
Reference 59 Enhanced cytotoxic effects of arsenite in combination with anthocyanidin compound, delphinidin, against a human leukemia cell line, HL-60. Chem Biol Interact. 2018 Oct 1;294:9-17.
Reference 60 Sulforaphane sensitizes tumor necrosis factor-related apoptosis-inducing ligand (TRAIL)-resistant hepatoma cells to TRAIL-induced apoptosis through reactive oxygen species-mediated up-regulation of DR5. Cancer Res. 2006 Feb 1;66(3):1740-50.
Reference 61 Molecular mechanisms of apoptosis and autophagy elicited by combined treatment with oridonin and cetuximab in laryngeal squamous cell carcinoma. Apoptosis. 2019 Feb;24(1-2):33-45.
Reference 62 Galangin sensitizes TRAIL-induced apoptosis through down-regulation of anti-apoptotic proteins in renal carcinoma Caki cells. Sci Rep. 2016 Jan 4;6:18642.
Reference 63 All-trans retinoic acid prevents cisplatin-induced nephrotoxicity in rats. Naunyn Schmiedebergs Arch Pharmacol. 2019 Feb;392(2):159-164.
Reference 64 Enhanced antitumor efficacy by the combination of emodin and gemcitabine against human pancreatic cancer cells via downregulation of the expression of XIAP in vitro and in vivo. Int J Oncol. 2011 Nov;39(5):1123-31.
Reference 65 Synergistic inhibition of head and neck tumor growth by green tea (-)-epigallocatechin-3-gallate and EGFR tyrosine kinase inhibitor. Int J Cancer. 2008 Sep 1;123(5):1005-14.
Reference 66 Rapid induction of apoptosis by combination of flavopiridol and tumor necrosis factor (TNF)-alpha or TNF-related apoptosis-inducing ligand in human cancer cell lines. Cancer Res. 2003 Feb 1;63(3):621-6.
Reference 67 Luteolin and Gemcitabine Protect Against Pancreatic Cancer in an Orthotopic Mouse Model. Pancreas. 2015 Jan;44(1):144-51.
Reference 68 Cardamonin, a natural chalcone, reduces 5-fluorouracil resistance of gastric cancer cells through targeting Wnt/beta-catenin signal pathway. Invest New Drugs. 2020 Apr;38(2):329-339.
Reference 69 Lycopene sensitizes the cervical cancer cells to cisplatin via targeting nuclear factor- kappa B (NF-kappaB) pathway. Turk J Med Sci. 2021 Feb 26;51(1):368-374.
Reference 70 Ursolic acid inhibits proliferation and reverses drug resistance of ovarian cancer stem cells by downregulating ABCG2 through suppressing the expression of hypoxia-inducible factor-1alpha in vitro. Oncol Rep. 2016 Jul;36(1):428-40.
Reference 71 In Vitro Evaluation of Sulforaphane and a Natural Analog as Potent Inducers of 5-Fluorouracil Anticancer Activity. Molecules. 2018 Nov 21;23(11):3040.
Reference 72 Wogonoside protects against dextran sulfate sodium-induced experimental colitis in mice by inhibiting NF-KappaB and NLRP3 inflammasome activation. Biochem Pharmacol. 2015 Mar 15;94(2):142-54.
Reference 73 Garcinol Alone and in Combination With Cisplatin Affect Cellular Behavior and PI3K/AKT Protein Phosphorylation in Human Ovarian Cancer Cells. Dose Response. 2020 May 19;18(2):1559325820926732.
Reference 74 1-Deoxynojirimycin (DNJ) Ameliorates Indomethacin-Induced Gastric Ulcer in Mice by Affecting NF-kappaB Signaling Pathway. Front Pharmacol. 2018 Apr 19;9:372.
Reference 75 Dicoumarol potentiates cisplatin-induced apoptosis mediated by c-Jun N-terminal kinase in p53 wild-type urogenital cancer cell lines. Oncogene. 2006 Apr 20;25(17):2500-8.
Reference 76 Effect of resveratrol and in combination with 5-FU on murine liver cancer. World J Gastroenterol. 2004 Oct 15;10(20):3048-52.
Reference 77 Synergistic anticancer effects of combined gamma-tocotrienol and celecoxib treatment are associated with suppression in Akt and NFkappaB signaling. Biomed Pharmacother. 2010 May;64(5):327-32.
Reference 78 Eugenol potentiates cisplatin anti-cancer activity through inhibition of ALDH-positive breast cancer stem cells and the NF-kappaB signaling pathway. Mol Carcinog. 2018 Mar;57(3):333-346.
Reference 79 The Cardenolide Glycoside Acovenoside A Affords Protective Activity in Doxorubicin-Induced Cardiotoxicity in Mice. J Pharmacol Exp Ther. 2016 Aug;358(2):262-70.
Reference 80 Resveratrol sensitizes androgen independent prostate cancer cells to death-receptor mediated apoptosis through multiple mechanisms. Prostate. 2007 Nov 1;67(15):1641-53.
Reference 81 Synergistic cytotoxicity of BIIB021 with triptolide through suppression of PI3K/Akt/mTOR and NF-KappaB signal pathways in thyroid carcinoma cells. Biomed Pharmacother. 2016 Oct;83:22-32.
Reference 82 Combined Parthenolide and Balsalazide Have Enhanced Antitumor Efficacy Through Blockade of NF-KappaB Activation. Mol Cancer Res. 2017 Feb;15(2):141-151.
Reference 83 Reversal of 5-fluorouracil resistance by EGCG is mediate by inactivation of TFAP2A/VEGF signaling pathway and down-regulation of MDR-1 and P-gp expression in gastric cancer. Oncotarget. 2017 Sep 6;8(47):82842-82853.
Reference 84 A novel combination of astilbin and low-dose methotrexate respectively targeting A 2A AR and its ligand adenosine for the treatment of collagen-induced arthritis. Biochem Pharmacol. 2018 Jul;153:269-281.
Reference 85 Combination of paromomycin and miltefosine promotes TLR4-dependent induction of antileishmanial immune response in vitro. J Antimicrob Chemother. 2012 Oct;67(10):2373-8.
Reference 86 Suppression of NF-KappaB signaling and P-glycoprotein function by gambogic acid synergistically potentiates adriamycin -induced apoptosis in lung cancer. Curr Cancer Drug Targets. 2014;14(1):91-103.
Reference 87 Combinatorial effects of thymoquinone on the anti-cancer activity of doxorubicin. Cancer Chemother Pharmacol. 2011 Apr;67(4):867-74.
Reference 88 Celastrol synergistically enhances temozolomide cytotoxicity in melanoma cells. Mol Cancer Res. 2009 Dec;7(12):1946-53.
Reference 89 Effect of taxifolin/dapagliflozin combination on colistin-induced nephrotoxicity in rats. Hum Exp Toxicol. 2021 Apr 22;9603271211010906.
Reference 90 Molecular mechanisms for inhibition of colon cancer cells by combined epigenetic-modulating epigallocatechin gallate and sodium butyrate. Exp Cell Res. 2014 May 15;324(1):40-53.
Reference 91 Co-application of arsenic trioxide (As2O3) and cisplatin (CDDP) on human SY-5Y neuroblastoma cells has differential effects on the intracellular calcium concentration ([Ca2+]i) and cytotoxicity. Neurotoxicology. 2009 Mar;30(2):194-202.
Reference 92 Simultaneous NF-kappaB inhibition and E-cadherin upregulation mediate mutually synergistic anticancer activity of celastrol and SAHA in vitro and in vivo. Int J Cancer. 2014 Oct 1;135(7):1721-32.
Reference 93 Synergistic anticancer activity of capsaicin and 3,3'-diindolylmethane in human colorectal cancer. J Agric Food Chem. 2015 May 6;63(17):4297-304.
Reference 94 6-Shogaol inhibits breast and colon cancer cell proliferation through activation of peroxisomal proliferator activated receptor Gamma (PPARGamma). Cancer Lett. 2013 Aug 9;336(1):127-39.
Reference 95 Beta-Catenin and NF-KappaB co-activation triggered by TLR3 stimulation facilitates stem cell-like phenotypes in breast cancer. Cell Death Differ. 2015 Feb;22(2):298-310.
Reference 96 Anticancer activity of cryptotanshinone on acute lymphoblastic leukemia cells. Arch Toxicol. 2016 Sep;90(9):2275-2286.
Reference 97 Apoptosis induction through proteasome inhibitory activity of cucurbitacin D in human T-cell leukemia. Cancer. 2011 Jun 15;117(12):2735-46.
Reference 98 Fucoxanthin and its deacetylated product, fucoxanthinol, induce apoptosis of primary effusion lymphomas. Cancer Lett. 2011 Jan 28;300(2):225-34.
Reference 99 The synergistic anti-inflammatory effects of lycopene, lutein, Beta-carotene, and carnosic acid combinations via redox-based inhibition of NF-KappaB signaling. Free Radic Biol Med. 2012 Oct 1;53(7):1381-91.
Reference 100 Oridonin protects LPS-induced acute lung injury by modulating Nrf2-mediated oxidative stress and Nrf2-independent NLRP3 and NF-KappaB pathways. Cell Commun Signal. 2019 Jun 11;17(1):62.
Reference 101 Proanthocyanidin alleviates doxorubicin-induced cardiac injury by inhibiting NF-kB pathway and modulating oxidative stress, cell cycle, and fibrogenesis. J Biochem Mol Toxicol. 2021 Apr;35(4):e22716.
Reference 102 In silico analysis and experimental validation of molecular mechanisms of salvianolic acid A-inhibited LPS-stimulated inflammation, in RAW264.7 macrophages. Cell Prolif. 2013 Oct;46(5):595-605.
Reference 103 IKKbeta-mediated nuclear factor-kappaB activation attenuates smac mimetic-induced apoptosis in cancer cells. Mol Cancer Ther. 2009 Jun;8(6):1636-45.
Reference 104 NF-KappaB inhibition by dimethylaminoparthenolide radiosensitizes non-small-cell lung carcinoma by blocking DNA double-strand break repair. Cell Death Discov. 2018 Feb 7;4:10.
Cite NPCDR
Visitor Map
Correspondence

X. N. Sun, Y. T. Zhang, Y. Zhou, X. C. Lian, L. L. Yan, T. Pan, T. Jin, H. Xie, Z. M. Liang, W. Q. Qiu, J. X. Wang, Z. R. Li, F. Zhu*, X. B. Sui*. NPCDR: natural product-based drug combination and its disease-specific molecular regulation. Nucleic Acids Research. 50(D1): 1324-1333 (2020). PMID: 34664659

Prof. Feng ZHU  (zhufeng@zju.edu.cn)

College of Pharmaceutical Sciences, Zhejiang University, Hangzhou, China


Prof. Xinbing SUI  (suilab@hznu.edu.cn)

School of Pharmacy and Department of Medical Oncology, the Affiliated Hospital of Hangzhou Normal University, Hangzhou Normal University, Hangzhou, China