Skip to main content
  •   Home
  •   Download
  •   Manual
  •   Contact

Molecule Details

General Information of the Molecule
Name
Apoptosis regulator BAX (BAX)
Synonyms
Bcl-2-like protein 4; Bcl2-L-4
Gene Name
BAX
Gene ID
581
Sequence
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV
LTASLTIWKKMG
    Click to Show/Hide
Function
Plays a role in the mitochondrial apoptotic process. Under normal conditions, BAX is largely cytosolic via constant retrotranslocation from mitochondria to the cytosol mediated by BCL2L1/Bcl-xL, which avoids accumulation of toxic BAX levels at the mitochondrial outer membrane (MOM). Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis.
    Click to Show/Hide
Uniprot ID
BAX_HUMAN
TC Number
TC: 1.A.21.1.2
Pfam
PF00452
KEGG ID
hsa581
TTD ID
T89251
A List of Drug Combination(s) Able to Regulate This Molecule
          Expression Regulation     Click to Show/Hide the Drug Combination Regulating This Molecule
                 Down-regulation     Click to Show/Hide
                    Drug Combination 1 Down-regulating the Expression of This Molecule [1]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Jerusalem artichoke + Interferon alpha-2a + Ribavirin
    Click to Show/Hide the Each NP or Drug Structure of This Combination
Jerusalem artichoke   NP Info     Drug Info 
Interferon alpha-2a   NP Info 
                    Drug Combination 2 Down-regulating the Expression of This Molecule [2]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Alpha linolenic acid   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 3 Down-regulating the Expression of This Molecule [3]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Anisodamine   NP Info  + Neostigmine   Drug Info 
                    Structure +
                    Drug Combination 4 Down-regulating the Expression of This Molecule [4]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Alpha linolenic acid   NP Info  + Gentamicin   Drug Info 
                    Structure +
                    Drug Combination 5 Down-regulating the Expression of This Molecule [5]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Acteoside + Paeoniflorin + X-ray irradiation
    Click to Show/Hide the Each NP or Drug Structure of This Combination
Acteoside   NP Info     Drug Info 
Paeoniflorin   NP Info 
                    Drug Combination 6 Down-regulating the Expression of This Molecule [6]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Alpha linolenic acid   NP Info  + Doxorubicin   Drug Info 
                    Structure +
                    Drug Combination 7 Down-regulating the Expression of This Molecule [7]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + 2-deoxy-D-glucose   Drug Info 
                    Structure +
                    Drug Combination 8 Down-regulating the Expression of This Molecule [8]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Pentagalloylglucose   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                 Up-regulation     Click to Show/Hide
                    Drug Combination 1 Up-regulating the Expression of This Molecule [9]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 2 Up-regulating the Expression of This Molecule [10]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Quercetin   NP Info  + Temozolomide   Drug Info 
                    Structure +
                    Drug Combination 3 Up-regulating the Expression of This Molecule [11]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Osthole   NP Info  + Trastuzumab   Drug Info 
                    Structure +
                    Drug Combination 4 Up-regulating the Expression of This Molecule [12]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Wogonin   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 5 Up-regulating the Expression of This Molecule [13]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Celastrol   NP Info  + Apatinib   Drug Info 
                    Structure +
                    Drug Combination 6 Up-regulating the Expression of This Molecule [14]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Bufalin   NP Info  + Sorafenib   Drug Info 
                    Structure +
                    Drug Combination 7 Up-regulating the Expression of This Molecule [15]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Resveratrol   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 8 Up-regulating the Expression of This Molecule [16]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Pterostilbene   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 9 Up-regulating the Expression of This Molecule [17]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Quercetin   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 10 Up-regulating the Expression of This Molecule [18]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Triptolide   NP Info  + Vasostatin   Drug Info 
                    Structure +
                    Drug Combination 11 Up-regulating the Expression of This Molecule [19]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Elemene   NP Info  + Etoposide   Drug Info 
                    Structure +
                    Drug Combination 12 Up-regulating the Expression of This Molecule [20]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Resveratrol   NP Info  + Doxorubicin   Drug Info 
                    Structure +
                    Drug Combination 13 Up-regulating the Expression of This Molecule [21]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Carnosic acid   NP Info  + Tamoxifen   Drug Info 
                    Structure +
                    Drug Combination 14 Up-regulating the Expression of This Molecule [22]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Fisetin   NP Info  + Sorafenib   Drug Info 
                    Structure +
                    Drug Combination 15 Up-regulating the Expression of This Molecule [23]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name 6-shogaol   NP Info  + TNF-related apoptosis inducing ligand    Drug Info 
                    Structure +
                    Drug Combination 16 Up-regulating the Expression of This Molecule [24]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Parthenolide   NP Info  + Epirubicin   Drug Info 
                    Structure +
                    Drug Combination 17 Up-regulating the Expression of This Molecule [25]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Paeonol   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 18 Up-regulating the Expression of This Molecule [26]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Schisandrol B   NP Info  + Apatinib   Drug Info 
                    Structure +
                    Drug Combination 19 Up-regulating the Expression of This Molecule [27]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Lycopene   NP Info  + Eicosapentaenoic acid   Drug Info 
                    Structure +
                    Drug Combination 20 Up-regulating the Expression of This Molecule [28]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Triptolide   NP Info  + Lcotinib   Drug Info 
                    Structure +
                    Drug Combination 21 Up-regulating the Expression of This Molecule [29]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Chlorogenic acid   NP Info  + Methotrexate   Drug Info 
                    Structure +
                    Drug Combination 22 Up-regulating the Expression of This Molecule [30]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Resveratrol   NP Info  + ABT-737   Drug Info 
                    Structure +
                    Drug Combination 23 Up-regulating the Expression of This Molecule [31]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Triptolide   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 24 Up-regulating the Expression of This Molecule [32]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Gambogic acid   NP Info  + Doxorubicin   Drug Info 
                    Structure +
                    Drug Combination 25 Up-regulating the Expression of This Molecule [33]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Gambogic acid   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 26 Up-regulating the Expression of This Molecule [34]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Shikonin   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 27 Up-regulating the Expression of This Molecule [35]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + Mitomycin C   Drug Info 
                    Structure +
                    Drug Combination 28 Up-regulating the Expression of This Molecule [36]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Allyl isothiocyanate   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 29 Up-regulating the Expression of This Molecule [37]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Piperlongumine   NP Info  + Oxaliplatin   Drug Info 
                    Structure +
                    Drug Combination 30 Up-regulating the Expression of This Molecule [38]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Ceramide   NP Info  + N, N-dimethyl-D-erythro-sphingosine   Drug Info 
                    Drug Combination 31 Up-regulating the Expression of This Molecule [39]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Apigenin   NP Info  + ABT-263   Drug Info 
                    Structure +
                    Drug Combination 32 Up-regulating the Expression of This Molecule [40]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Methylglyoxal   NP Info  + Glyoxalase I   Drug Info 
                    Structure +
                    Drug Combination 33 Up-regulating the Expression of This Molecule [41]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Resveratrol   NP Info  + Raloxifene   Drug Info 
                    Structure +
                    Drug Combination 34 Up-regulating the Expression of This Molecule [42]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Bufalin   NP Info  + Doxorubicin   Drug Info 
                    Structure +
                    Drug Combination 35 Up-regulating the Expression of This Molecule [43]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Epigallocatechin gallate   NP Info  + TNF-related apoptosis inducing ligand    Drug Info 
                    Structure +
                    Drug Combination 36 Up-regulating the Expression of This Molecule [44]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Demethoxycurcumin   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 37 Up-regulating the Expression of This Molecule [45]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name 6-shogaol   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 38 Up-regulating the Expression of This Molecule [46]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Genistein   NP Info  + HA14-1   Drug Info 
                    Structure +
                    Drug Combination 39 Up-regulating the Expression of This Molecule [47]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Tangeretin   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 40 Up-regulating the Expression of This Molecule [48]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Fisetin   NP Info  + Cabazitaxel   Drug Info 
                    Structure +
                    Drug Combination 41 Up-regulating the Expression of This Molecule [49]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Tanshinone IIA   NP Info  + Doxorubicin   Drug Info 
                    Structure +
                    Drug Combination 42 Up-regulating the Expression of This Molecule [50]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + 1,25-dihydroxyvitamin D3   Drug Info 
                    Structure +
                    Drug Combination 43 Up-regulating the Expression of This Molecule [51]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Hesperetin   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 44 Up-regulating the Expression of This Molecule [52]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Ferulic acid   NP Info  + Insulin   Drug Info 
                    Structure +
                    Drug Combination 45 Up-regulating the Expression of This Molecule [53]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Gossypol   NP Info  + Zoledronic   Drug Info 
                    Structure +
                    Drug Combination 46 Up-regulating the Expression of This Molecule [54]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Thymoquinone   NP Info  + Gemcitabine   Drug Info 
                    Structure +
                    Drug Combination 47 Up-regulating the Expression of This Molecule [55]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Triptolide   NP Info  + Aspirin   Drug Info 
                    Structure +
                    Drug Combination 48 Up-regulating the Expression of This Molecule [56]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Quercetin   NP Info  + 2-methoxyestradiol   Drug Info 
                    Structure +
                    Drug Combination 49 Up-regulating the Expression of This Molecule [57]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Gallic acid   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 50 Up-regulating the Expression of This Molecule [58]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Genistein   NP Info  + Centchroman   Drug Info 
                    Structure +
                    Drug Combination 51 Up-regulating the Expression of This Molecule [59]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Thymoquinone   NP Info  + Topotecan   Drug Info 
                    Structure +
                    Drug Combination 52 Up-regulating the Expression of This Molecule [60]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + Deferoxamine   Drug Info 
                    Structure +
                    Drug Combination 53 Up-regulating the Expression of This Molecule [61]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Piperine   NP Info  + Mitomycin C   Drug Info 
                    Structure +
                    Drug Combination 54 Up-regulating the Expression of This Molecule [62]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Ellagic acid   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 55 Up-regulating the Expression of This Molecule [63]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Artesunate   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 56 Up-regulating the Expression of This Molecule [64]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Flavopiridol   NP Info  + Gemcitabine   Drug Info 
                    Structure +
                    Drug Combination 57 Up-regulating the Expression of This Molecule [65]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Betulinic Acid   NP Info  + Sorafenib   Drug Info 
                    Structure +
                    Drug Combination 58 Up-regulating the Expression of This Molecule [66]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Gossypol   NP Info  + Doxorubicin   Drug Info 
                    Structure +
                    Drug Combination 59 Up-regulating the Expression of This Molecule [67]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Elemene   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 60 Up-regulating the Expression of This Molecule [68]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Luteolin   NP Info  + Oxaliplatin   Drug Info 
                    Structure +
                    Drug Combination 61 Up-regulating the Expression of This Molecule [69]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Luteolin   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 62 Up-regulating the Expression of This Molecule [70]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Triptolide   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 63 Up-regulating the Expression of This Molecule [71]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Eugenol   NP Info  + 2-methoxyestradiol   Drug Info 
                    Structure +
                    Drug Combination 64 Up-regulating the Expression of This Molecule [72]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Resveratrol   NP Info  + Sorafenib   Drug Info 
                    Structure +
                    Drug Combination 65 Up-regulating the Expression of This Molecule [73]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Triptolide   NP Info  + Gefitinib   Drug Info 
                    Structure +
                    Drug Combination 66 Up-regulating the Expression of This Molecule [74]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Noscapine   NP Info  + Doxorubicin   Drug Info 
                    Structure +
                    Drug Combination 67 Up-regulating the Expression of This Molecule [75]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Amentoflavone   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 68 Up-regulating the Expression of This Molecule [76]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Thymoquinone   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 69 Up-regulating the Expression of This Molecule [77]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Paclitaxel   NP Info  + Coralyne   Drug Info 
                    Structure +
                    Drug Combination 70 Up-regulating the Expression of This Molecule [78]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + Carboplatin   Drug Info 
                    Structure +
                    Drug Combination 71 Up-regulating the Expression of This Molecule [79]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 72 Up-regulating the Expression of This Molecule [80]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Nobiletin   NP Info  + Sorafenib   Drug Info 
                    Structure +
                    Drug Combination 73 Up-regulating the Expression of This Molecule [81]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Noscapine   NP Info  + Gemcitabine   Drug Info 
                    Structure +
                    Drug Combination 74 Up-regulating the Expression of This Molecule [82]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Cordycepin   NP Info  + Apatinib   Drug Info 
                    Structure +
                    Drug Combination 75 Up-regulating the Expression of This Molecule [83]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Apigenin   NP Info  + TNF-related apoptosis inducing ligand    Drug Info 
                    Structure +
                    Drug Combination 76 Up-regulating the Expression of This Molecule [84]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Resveratrol   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 77 Up-regulating the Expression of This Molecule [85]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Chrysin   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 78 Up-regulating the Expression of This Molecule [86]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + TNF-related apoptosis inducing ligand    Drug Info 
                    Structure +
                    Drug Combination 79 Up-regulating the Expression of This Molecule [87]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Oridonin   NP Info  + Imatinib   Drug Info 
                    Structure +
                    Drug Combination 80 Up-regulating the Expression of This Molecule [88]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + Valproic acid   Drug Info 
                    Structure +
                    Drug Combination 81 Up-regulating the Expression of This Molecule [89]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Gambogic acid   NP Info  + Gefitinib   Drug Info 
                    Structure +
                    Drug Combination 82 Up-regulating the Expression of This Molecule [90]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Cinnamaldehyde   NP Info  + Doxorubicin   Drug Info 
                    Structure +
                    Drug Combination 83 Up-regulating the Expression of This Molecule [91]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Bufalin   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 84 Up-regulating the Expression of This Molecule [92]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Epigallocatechin gallate   NP Info  + Vorinostat   Drug Info 
                    Structure +
                    Drug Combination 85 Up-regulating the Expression of This Molecule [93]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Thymoquinone   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 86 Up-regulating the Expression of This Molecule [94]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Osthole   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 87 Up-regulating the Expression of This Molecule [95]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Eugenol   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 88 Up-regulating the Expression of This Molecule [96]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Sulforaphane   NP Info  + TNF-related apoptosis inducing ligand    Drug Info 
                    Structure +
                    Drug Combination 89 Up-regulating the Expression of This Molecule [97]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Genistein   NP Info  + Selenite   Drug Info 
                    Structure +
                    Drug Combination 90 Up-regulating the Expression of This Molecule [98]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + PD98059   Drug Info 
                    Structure +
                    Drug Combination 91 Up-regulating the Expression of This Molecule [99]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Celastrol   NP Info  + ABT-737   Drug Info 
                    Structure +
                    Drug Combination 92 Up-regulating the Expression of This Molecule [100]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Genistein   NP Info  + Cabazitaxel   Drug Info 
                    Structure +
                    Drug Combination 93 Up-regulating the Expression of This Molecule [101]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Noscapine   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 94 Up-regulating the Expression of This Molecule [102]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Emodin   NP Info  + Cytarabine   Drug Info 
                    Structure +
                    Drug Combination 95 Up-regulating the Expression of This Molecule [103]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Saikosaponin D   NP Info  + SP600125   Drug Info 
                    Structure +
                    Drug Combination 96 Up-regulating the Expression of This Molecule [104]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Sulforaphane   NP Info  + Imatinib   Drug Info 
                    Structure +
                    Drug Combination 97 Up-regulating the Expression of This Molecule [105]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Galangin   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 98 Up-regulating the Expression of This Molecule [106]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Cyanidin-3-O-glucoside chloride   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 99 Up-regulating the Expression of This Molecule [107]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Kaempferol   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 100 Up-regulating the Expression of This Molecule [108]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Chlorogenic acid   NP Info  + Regorafenib   Drug Info 
                    Structure +
                    Drug Combination 101 Up-regulating the Expression of This Molecule [98]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + PD184352   Drug Info 
                    Structure +
                    Drug Combination 102 Up-regulating the Expression of This Molecule [109]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Piperine   NP Info  + Celecoxib   Drug Info 
                    Structure +
                    Drug Combination 103 Up-regulating the Expression of This Molecule [110]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Resveratrol   NP Info  + Temozolomide   Drug Info 
                    Structure +
                    Drug Combination 104 Up-regulating the Expression of This Molecule [111]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + Sorafenib   Drug Info 
                    Structure +
                    Drug Combination 105 Up-regulating the Expression of This Molecule [112]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Luteolin   NP Info  + Celecoxib   Drug Info 
                    Structure +
                    Drug Combination 106 Up-regulating the Expression of This Molecule [7]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + 2-deoxy-D-glucose   Drug Info 
                    Structure +
                    Drug Combination 107 Up-regulating the Expression of This Molecule [113]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + Gilteritinib   Drug Info 
                    Structure +
                    Drug Combination 108 Up-regulating the Expression of This Molecule [114]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Tetrandrine   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 109 Up-regulating the Expression of This Molecule [115]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Furanodiene   NP Info  + Germacrone   Drug Info 
                    Structure +
                    Drug Combination 110 Up-regulating the Expression of This Molecule [116]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Theaflavin-3,3'-digallate + Black tea polyphenol + Cisplatin
    Click to Show/Hide the Each NP or Drug Structure of This Combination
Theaflavin-3,3'-digallate   NP Info     Drug Info 
Black tea polyphenol   NP Info 
                    Drug Combination 111 Up-regulating the Expression of This Molecule [117]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Metformin   NP Info  + Pemetrexed   Drug Info 
                    Structure +
                    Drug Combination 112 Up-regulating the Expression of This Molecule [118]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Gingerol   NP Info  + TNF-related apoptosis inducing ligand    Drug Info 
                    Structure +
                    Drug Combination 113 Up-regulating the Expression of This Molecule [119]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + Polyinosinic acid-polycytidylic acid   Drug Info 
                    Structure +
                    Drug Combination 114 Up-regulating the Expression of This Molecule [120]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Daidzein   NP Info  + Topotecan   Drug Info 
                    Structure +
                    Drug Combination 115 Up-regulating the Expression of This Molecule [121]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Capsaicin   NP Info  + 3,3'-diindolylmethane   Drug Info 
                    Structure +
                    Drug Combination 116 Up-regulating the Expression of This Molecule [9]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + Doxorubicin   Drug Info 
                    Structure +
                    Drug Combination 117 Up-regulating the Expression of This Molecule [122]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Brusatol   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 118 Up-regulating the Expression of This Molecule [123]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Capsaicin   NP Info  + Sorafenib   Drug Info 
                    Structure +
                    Drug Combination 119 Up-regulating the Expression of This Molecule [124]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Licochalcone A   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 120 Up-regulating the Expression of This Molecule [28]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Triptolide   NP Info  + Erlotinib   Drug Info 
                    Structure +
                    Drug Combination 121 Up-regulating the Expression of This Molecule [125]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Ursolic acid   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 122 Up-regulating the Expression of This Molecule [126]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Borneol   NP Info  + Doxorubicin   Drug Info 
                    Structure +
Natural Product(s) of This Target
1 Cryptotanshinone  NP Info  Investigative Salvia miltiorrhiza
2 Nobiletin  NP Info  Investigative Ageratum conyzoides
References
Reference 1 Synergistic Effects of Jerusalem Artichoke in Combination with Pegylated Interferon Alfa-2a and Ribavirin Against Hepatic Fibrosis in Rats. Asian Pac J Cancer Prev. 2016;17(4):1979-85.
Reference 2 Alpha-linolenic acid confers protection on mice renal cells against cisplatin-induced nephrotoxicity. Cytotechnology. 2019 Oct;71(5):905-914.
Reference 3 Combined administration of anisodamine and neostigmine rescued acute lethal crush syndrome through Alpha7nAChR-dependent JAK2-STAT3 signaling. Sci Rep. 2016 Nov 22;6:37709.
Reference 4 Protective effect of alpha-linolenic acid on gentamicin-induced ototoxicity in mice. Somatosens Mot Res. 2017 Sep;34(3):145-150.
Reference 5 Protective effects of acteoside against X?ray?induced damage in human skin fibroblasts. Mol Med Rep. 2015 Aug;12(2):2301-6.
Reference 6 Alpha-Linolenic acid attenuates doxorubicin-induced cardiotoxicity in rats through suppression of oxidative stress and apoptosis. Acta Biochim Biophys Sin (Shanghai). 2013 Oct;45(10):817-26.
Reference 7 2-Deoxy-D-glucose cooperates with arsenic trioxide to induce apoptosis in leukemia cells: involvement of IGF-1R-regulated Akt/mTOR, MEK/ERK and LKB-1/AMPK signaling pathways. Biochem Pharmacol. 2012 Dec 15;84(12):1604-16.
Reference 8 Inhibitory effects and molecular mechanisms of pentagalloyl glucose in combination with 5-FU on aggressive phenotypes of HepG2 cells. Nat Prod Res. 2021 Mar;35(5):815-818.
Reference 9 Curcumin enhances cytotoxicity of chemotherapeutic agents in prostate cancer cells by inducing p21(WAF1/CIP1) and C/EBPbeta expressions and suppressing NF-kappaB activation. Prostate. 2002 May 15;51(3):211-8.
Reference 10 Quercetin abrogates chemoresistance in melanoma cells by modulating deltaNp73. BMC Cancer. 2010 Jun 11;10:282.
Reference 11 Osthole Synergizes With HER2 Inhibitor, Trastuzumab in HER2-Overexpressed N87 Gastric Cancer by Inducing Apoptosis and Inhibition of AKT-MAPK Pathway. Front Pharmacol. 2018 Nov 27;9:1392.
Reference 12 Wogonin potentiates the antitumor effects of low dose 5-fluorouracil against gastric cancer through induction of apoptosis by down-regulation of NF-kappaB and regulation of its metabolism. Toxicol Lett. 2010 Sep 1;197(3):201-10.
Reference 13 The coordinated effects of Apatinib and Tripterine on the proliferation, invasiveness and apoptosis of human hepatoma Hep3B cells. Oncol Lett. 2018 Jul;16(1):353-361.
Reference 14 Bufalin enhances the anti-proliferative effect of sorafenib on human hepatocellular carcinoma cells through downregulation of ERK. Mol Biol Rep. 2012 Feb;39(2):1683-9.
Reference 15 Effect of resveratrol and in combination with 5-FU on murine liver cancer. World J Gastroenterol. 2004 Oct 15;10(20):3048-52.
Reference 16 Pterostilbine, an active component of blueberries, sensitizes colon cancer cells to 5-fluorouracil cytotoxicity. Sci Rep. 2015 Oct 16;5:15239.
Reference 17 Quercetin enhances 5-fluorouracil-induced apoptosis in MSI colorectal cancer cells through p53 modulation. Cancer Chemother Pharmacol. 2011 Dec;68(6):1449-57.
Reference 18 Herbal compound triptolide synergistically enhanced antitumor activity of vasostatin120-180. Anticancer Drugs. 2013 Oct;24(9):945-57.
Reference 19 Synergistic antitumor effect of Beta-elemene and etoposide is mediated via induction of cell apoptosis and cell cycle arrest in non-small cell lung carcinoma cells. Mol Med Rep. Nov-Dec 2011;4(6):1189-93.
Reference 20 Resveratrol enhances the cytotoxic profile of docetaxel and doxorubicin in solid tumour cell lines in vitro. Cell Prolif. 2011 Dec;44(6):591-601.
Reference 21 Carnosic acid cooperates with tamoxifen to induce apoptosis associated with Caspase-3 activation in breast cancer cells in vitro and in vivo. Biomed Pharmacother. 2017 May;89:827-837.
Reference 22 Fisetin, a phytochemical, potentiates sorafenib-induced apoptosis and abrogates tumor growth in athymic nude mice implanted with BRAF-mutated melanoma cells. Oncotarget. 2015 Sep 29;6(29):28296-311.
Reference 23 6-Shogaol enhances renal carcinoma Caki cells to TRAIL-induced apoptosis through reactive oxygen species-mediated cytochrome c release and down-regulation of c-FLIP(L) expression. Chem Biol Interact. 2015 Feb 25;228:69-78.
Reference 24 Anticancer and apoptotic activities of parthenolide in combination with epirubicin in mda-mb-468 breast cancer cells. Mol Biol Rep. 2020 Aug;47(8):5807-5815.
Reference 25 Synergistic effect of paeonol and cisplatin on oesophageal cancer cell lines. Dig Liver Dis. 2008 Jul;40(7):531-9.
Reference 26 The synergistic anti-tumor effect of schisandrin B and apatinib. J Asian Nat Prod Res. 2020 Sep;22(9):839-849.
Reference 27 Concomitant supplementation of lycopene and eicosapentaenoic acid inhibits the proliferation of human colon cancer cells. J Nutr Biochem. 2009 Jun;20(6):426-34.
Reference 28 Combined Treatment with Triptolide and Tyrosine Kinase Inhibitors Synergistically Enhances Apoptosis in Non-small Cell Lung Cancer H1975 Cells but Not H1299 Cells through EGFR/Akt Pathway. Chem Pharm Bull (Tokyo). 2019 Aug 1;67(8):864-871.
Reference 29 Protective effect of Chlorogenic acid against methotrexate induced oxidative stress, inflammation and apoptosis in rat liver: An experimental approach. Chem Biol Interact. 2017 Jun 25;272:80-91.
Reference 30 Combination of ABT-737 and resveratrol enhances DNA damage and apoptosis in human T-cell acute lymphoblastic leukemia MOLT-4 cells. Toxicol In Vitro. 2017 Aug;42:38-46.
Reference 31 Triptolide simultaneously induces reactive oxygen species, inhibits NF-kappaB activity and sensitizes 5-fluorouracil in colorectal cancer cell lines. Cancer Lett. 2010 May 28;291(2):200-8.
Reference 32 Suppression of NF-KappaB signaling and P-glycoprotein function by gambogic acid synergistically potentiates adriamycin -induced apoptosis in lung cancer. Curr Cancer Drug Targets. 2014;14(1):91-103.
Reference 33 Combination of gambogic acid with cisplatin enhances the antitumor effects on cisplatin-resistant lung cancer cells by downregulating MRP2 and LRP expression. Onco Targets Ther. 2016 Jun 2;9:3359-68.
Reference 34 Enhancement of cisplatin-induced colon cancer cells apoptosis by shikonin, a natural inducer of ROS in vitro and in vivo. Biochem Biophys Res Commun. 2016 Jan 22;469(4):1075-82.
Reference 35 Curcumin enhances the mitomycin C-induced cytotoxicity via downregulation of MKK1/2-ERK1/2-mediated Rad51 expression in non-small cell lung cancer cells. Toxicol Appl Pharmacol. 2011 Sep 15;255(3):327-38.
Reference 36 Synergistic effect of allyl isothiocyanate (AITC) on cisplatin efficacy in vitro and in vivo. Am J Cancer Res. 2015 Jul 15;5(8):2516-30.
Reference 37 The synergistic effects of oxaliplatin and piperlongumine on colorectal cancer are mediated by oxidative stress. Cell Death Dis. 2019 Aug 8;10(8):600.
Reference 38 Enhancement of radiosensitivity by combined ceramide and dimethylsphingosine treatment in lung cancer cells. Exp Mol Med. 2004 Oct 31;36(5):411-9.
Reference 39 Apigenin sensitizes colon cancer cells to antitumor activity of ABT-263. Mol Cancer Ther. 2013 Dec;12(12):2640-50.
Reference 40 Synergistic inhibition of colon cancer growth by the combination of methylglyoxal and silencing of glyoxalase I mediated by the STAT1 pathway. Oncotarget. 2017 Jun 22;8(33):54838-54857.
Reference 41 Apoptosis induction in human breast cancer cell lines by synergic effect of raloxifene and resveratrol through increasing proapoptotic genes. Life Sci. 2018 Jul 15;205:45-53.
Reference 42 Combination of Cinobufacini and Doxorubicin Increases Apoptosis of Hepatocellular Carcinoma Cells through the Fas- and Mitochondria-Mediated Pathways. Am J Chin Med. 2017;45(7):1537-1556.
Reference 43 Green tea polyphenol EGCG sensitizes human prostate carcinoma LNCaP cells to TRAIL-mediated apoptosis and synergistically inhibits biomarkers associated with angiogenesis and metastasis. Oncogene. 2008 Mar 27;27(14):2055-63.
Reference 44 Demethoxycurcumin sensitizes the response of non-small cell lung cancer to cisplatin through downregulation of TP and ERCC1-related pathways. Phytomedicine. 2019 Feb;53:28-36.
Reference 45 6-Shogaol enhances the anticancer effect of 5-fluorouracil, oxaliplatin, and irinotecan via increase of apoptosis and autophagy in colon cancer cells in hypoxic/aglycemic conditions. BMC Complement Med Ther. 2020 May 11;20(1):141.
Reference 46 Bcl-2 inhibitor HA14-1 and genistein together adeptly down regulated survival factors and activated cysteine proteases for apoptosis in human malignant neuroblastoma SK-N-BE2 and SH-SY5Y cells. Brain Res. 2009 Aug 4;1283:155-66.
Reference 47 Synergistic therapy with tangeretin and 5-fluorouracil accelerates the ROS/JNK mediated apoptotic pathway in human colorectal cancer cell. Food Chem Toxicol. 2020 Sep;143:111529.
Reference 48 Fisetin Enhances Chemotherapeutic Effect of Cabazitaxel against Human Prostate Cancer Cells. Mol Cancer Ther. 2016 Dec;15(12):2863-2874.
Reference 49 Tanshinone IIA combined with adriamycin inhibited malignant biological behaviors of NSCLC A549 cell line in a synergistic way. BMC Cancer. 2016 Nov 18;16(1):899.
Reference 50 Low-dose 1,25-dihydroxyvitamin D(3) combined with arsenic trioxide synergistically inhibits proliferation of acute myeloid leukemia cells by promoting apoptosis. Oncol Rep. 2013 Jul;30(1):485-91.
Reference 51 Hesperetin Promotes Cisplatin-Induced Apoptosis of Gastric Cancer In Vitro and In Vivo by Upregulating PTEN Expression. Front Pharmacol. 2020 Aug 27;11:1326.
Reference 52 Beneficial effects of ferulic acid alone and in combination with insulin in streptozotocin induced diabetic neuropathy in Sprague Dawley rats. Life Sci. 2020 Aug 15;255:117856.
Reference 53 Targeting apoptosis in the hormone- and drug-resistant prostate cancer cell line, DU-145, by gossypol/zoledronic acid combination. Cell Biol Int. 2009 Nov;33(11):1165-72.
Reference 54 Thymoquinone Pretreatment Overcomes the Insensitivity and Potentiates the Antitumor Effect of Gemcitabine Through Abrogation of Notch1, PI3K/Akt/mTOR Regulated Signaling Pathways in Pancreatic Cancer. Dig Dis Sci. 2015 Apr;60(4):1067-80.
Reference 55 Enhanced anti-tumor efficacy of aspirin combined with triptolide in cervical cancer cells. Asian Pac J Cancer Prev. 2013;14(5):3041-4.
Reference 56 Combination of Quercetin and 2-Methoxyestradiol Enhances Inhibition of Human Prostate Cancer LNCaP and PC-3 Cells Xenograft Tumor Growth. PLoS One. 2015 May 26;10(5):e0128277.
Reference 57 Gallic acid has anticancer activity and enhances the anticancer effects of cisplatin in non?small cell lung cancer A549 cells via the JAK/STAT3 signaling pathway. Oncol Rep. 2019 Mar;41(3):1779-1788.
Reference 58 Genistein synergizes centchroman action in human breast cancer cells. Indian J Pharmacol. Nov-Dec 2016;48(6):637-642.
Reference 59 Antiproliferative and proapoptotic effects of topotecan in combination with thymoquinone on acute myelogenous leukemia. Clin Lymphoma Myeloma Leuk. 2014 Sep;14 Suppl:S46-55.
Reference 60 The growth-inhibitory and apoptosis-inducing effect of deferoxamine combined with arsenic trioxide on HL-60 xenografts in nude mice. Leuk Res. 2014 Sep;38(9):1085-90.
Reference 61 Piperine (PP) enhanced mitomycin-C (MMC) therapy of human cervical cancer through suppressing Bcl-2 signaling pathway via inactivating STAT3/NF-KappaB. Biomed Pharmacother. 2017 Dec;96:1403-1410.
Reference 62 Effects of ellagic acid on chemosensitivity to 5-fluorouracil in colorectal carcinoma cells. Anticancer Res. 2012 Oct;32(10):4413-8.
Reference 63 Artesunate exhibits synergistic anti-cancer effects with cisplatin on lung cancer A549 cells by inhibiting MAPK pathway. Gene. 2021 Jan 15;766:145134.
Reference 64 Flavopiridol increases sensitization to gemcitabine in human gastrointestinal cancer cell lines and correlates with down-regulation of ribonucleotide reductase M2 subunit. Clin Cancer Res. 2001 Aug;7(8):2527-36.
Reference 65 Synergistic activity of sorafenib and betulinic acid against clonogenic activity of non-small cell lung cancer cells. Cancer Sci. 2017 Nov;108(11):2265-2272.
Reference 66 Combination of L-gossypol and low-concentration doxorubicin induces apoptosis in human synovial sarcoma cells. Mol Med Rep. 2015 Oct;12(4):5924-32.
Reference 67 beta-Elemene, a novel plant-derived antineoplastic agent, increases cisplatin chemosensitivity of lung tumor cells by triggering apoptosis. Oncol Rep. 2009 Jul;22(1):161-70.
Reference 68 Luteolin sensitizes two oxaliplatin-resistant colorectal cancer cell lines to chemotherapeutic drugs via inhibition of the Nrf2 pathway. Asian Pac J Cancer Prev. 2014;15(6):2911-6.
Reference 69 Anti-proliferative and chemosensitizing effects of luteolin on human gastric cancer AGS cell line. Mol Cell Biochem. 2008 Jun;313(1-2):125-32.
Reference 70 Triptolide sensitizes cisplatin-resistant human epithelial ovarian cancer by inhibiting the phosphorylation of AKT. J Cancer. 2019 Jun 2;10(13):3012-3020.
Reference 71 Combination of 2-methoxyestradiol (2-ME2) and eugenol for apoptosis induction synergistically in androgen independent prostate cancer cells. J Steroid Biochem Mol Biol. 2009 Jan;113(1-2):25-35.
Reference 72 Resveratrol enhances the efficacy of sorafenib mediated apoptosis in human breast cancer MCF7 cells through ROS, cell cycle inhibition, caspase 3 and PARP cleavage. Biomed Pharmacother. 2016 Dec;84:1906-1914.
Reference 73 Triptolide inhibits epithelial?mesenchymal transition and induces apoptosis in gefitinib?resistant lung cancer cells. Oncol Rep. 2020 May;43(5):1569-1579.
Reference 74 Antitumor activity of Noscapine in combination with Doxorubicin in triple negative breast cancer. PLoS One. 2011 Mar 15;6(3):e17733.
Reference 75 Anticancer Efficacy and Mechanism of Amentoflavone for Sensitizing Oral Squamous Cell Carcinoma to Cisplatin. Anticancer Res. 2020 Dec;40(12):6723-6732.
Reference 76 Thymoquinone and cisplatin as a therapeutic combination in lung cancer: In vitro and in vivo. J Exp Clin Cancer Res. 2010 Jul 1;29(1):87.
Reference 77 Synergistic effects of coralyne and paclitaxel on cell migration and proliferation of breast cancer cells lines. Biomed Pharmacother. 2017 Jul;91:436-445.
Reference 78 Curcumin sensitizes human lung cancer cells to apoptosis and metastasis synergistically combined with carboplatin. Exp Biol Med (Maywood). 2015 Nov;240(11):1416-25.
Reference 79 Co-application of arsenic trioxide (As2O3) and cisplatin (CDDP) on human SY-5Y neuroblastoma cells has differential effects on the intracellular calcium concentration ([Ca2+]i) and cytotoxicity. Neurotoxicology. 2009 Mar;30(2):194-202.
Reference 80 Synergistic Effects of Nobiletin and Sorafenib Combination on Metastatic Prostate Cancer Cells. Nutr Cancer. 2019;71(8):1299-1312.
Reference 81 Enhanced anticancer activity of gemcitabine in combination with noscapine via antiangiogenic and apoptotic pathway against non-small cell lung cancer. PLoS One. 2011;6(11):e27394.
Reference 82 Combination of Cordycepin and Apatinib Synergistically Inhibits NSCLC Cells by Down-Regulating VEGF/PI3K/Akt Signaling Pathway. Front Oncol. 2020 Sep 7;10:1732.
Reference 83 Ethanolic Extract of Propolis Augments TRAIL-Induced Apoptotic Death in Prostate Cancer Cells. Evid Based Complement Alternat Med. 2011;2011:535172.
Reference 84 Resveratrol Enhances Chemosensitivity in Mouse Melanoma Model Through Connexin 43 Upregulation. Environ Toxicol. 2015 Jul 8;30(8):877-86.
Reference 85 Combination of chrysin and cisplatin promotes the apoptosis of Hep G2 cells by up-regulating p53. Chem Biol Interact. 2015 May 5;232:12-20.
Reference 86 Curcumin sensitizes tumor necrosis factor-related apoptosis-inducing ligand (TRAIL)-induced apoptosis through reactive oxygen species-mediated upregulation of death receptor 5 (DR5). Carcinogenesis. 2005 Nov;26(11):1905-13.
Reference 87 Oridonin in combination with imatinib exerts synergetic anti-leukemia effect in Ph+ acute lymphoblastic leukemia cells in vitro by inhibiting activation of LYN/mTOR signaling pathway. Cancer Biol Ther. 2012 Nov;13(13):1244-54.
Reference 88 Synergistic effects of valproic acid and arsenic trioxide on RPMI8226 cells in vitro and the possible underlying mechanisms. Mol Med Rep. 2015 Jul;12(1):1449-56.
Reference 89 Combined therapy with EGFR TKI and gambogic acid for overcoming resistance in EGFR-T790M mutant lung cancer. Oncol Lett. 2015 Oct;10(4):2063-2066.
Reference 90 Evaluation of the cytotoxic and apoptogenic effects of cinnamaldehyde on U87MG cells alone and in combination with doxorubicin. Res Pharm Sci. 2020 Feb 20;15(1):26-35.
Reference 91 Bufalin and 5-fluorouracil synergistically induce apoptosis in colorectal cancer cells. Oncol Lett. 2018 May;15(5):8019-8026.
Reference 92 Anti-melanoma effects of vorinostat in combination with polyphenolic antioxidant (-)-epigallocatechin-3-gallate (EGCG). Pharm Res. 2010 Jun;27(6):1103-14.
Reference 93 Thymoquinone subdues tumor growth and potentiates the chemopreventive effect of 5-fluorouracil on the early stages of colorectal carcinogenesis in rats. Drug Des Devel Ther. 2016 Jul 11;10:2239-53.
Reference 94 Combination of Osthole and Cisplatin Against Rhabdomyosarcoma TE671 Cells Yielded Additive Pharmacologic Interaction by Means of Isobolographic Analysis. Anticancer Res. 2018 Jan;38(1):205-210.
Reference 95 Eugenol potentiates cisplatin anti-cancer activity through inhibition of ALDH-positive breast cancer stem cells and the NF-kappaB signaling pathway. Mol Carcinog. 2018 Mar;57(3):333-346.
Reference 96 Sulforaphane sensitizes tumor necrosis factor-related apoptosis-inducing ligand (TRAIL)-resistant hepatoma cells to TRAIL-induced apoptosis through reactive oxygen species-mediated up-regulation of DR5. Cancer Res. 2006 Feb 1;66(3):1740-50.
Reference 97 Effects of selenite and genistein on G2/M cell cycle arrest and apoptosis in human prostate cancer cells. Nutr Cancer. 2009;61(3):397-407.
Reference 98 Treatment with arsenic trioxide (ATO) and MEK1 inhibitor activates the p73-p53AIP1 apoptotic pathway in leukemia cells. Blood. 2004 Jul 15;104(2):519-25.
Reference 99 Upregulating Noxa by ER stress, celastrol exerts synergistic anti-cancer activity in combination with ABT-737 in human hepatocellular carcinoma cells. PLoS One. 2012;7(12):e52333.
Reference 100 Genistein enhances the efficacy of cabazitaxel chemotherapy in metastatic castration-resistant prostate cancer cells. Prostate. 2013 Nov;73(15):1681-9.
Reference 101 Noscapine sensitizes chemoresistant ovarian cancer cells to cisplatin through inhibition of HIF-1Alpha. Cancer Lett. 2011 Jun 1;305(1):94-9.
Reference 102 Emodin and Its Combination with Cytarabine Induce Apoptosis in Resistant Acute Myeloid Leukemia Cells in Vitro and in Vivo. Cell Physiol Biochem. 2018;48(5):2061-2073.
Reference 103 Use of Saikosaponin D and JNK inhibitor SP600125, alone or in combination, inhibits malignant properties of human osteosarcoma U2 cells. Am J Transl Res. 2019 Apr 15;11(4):2070-2080.
Reference 104 Sulforaphane potentiates the efficacy of imatinib against chronic leukemia cancer stem cells through enhanced abrogation of Wnt/Beta-catenin function. J Agric Food Chem. 2012 Jul 18;60(28):7031-9.
Reference 105 Effects of flavonoids on cisplatin-induced apoptosis of HL-60 and L1210 leukemia cells. Leuk Res. 2003 Jan;27(1):65-72.
Reference 106 Combination of cyanidin-3-O-glucoside and cisplatin induces oxidative stress and apoptosis in HeLa cells by reducing activity of endogenous antioxidants, increasing bax/bcl-2 mRNA expression ratio, and downregulating Nrf2 expression. J Food Biochem. 2021 Jul;45(7):e13806.
Reference 107 Synergistic effect of kaempferol and 5?fluorouracil on the growth of colorectal cancer cells by regulating the PI3K/Akt signaling pathway. Mol Med Rep. 2019 Jul;20(1):728-734.
Reference 108 Chlorogenic Acid Improves the Regorafenib Effects in Human Hepatocellular Carcinoma Cells. Int J Mol Sci. 2018 May 19;19(5):1518.
Reference 109 Piperine and Celecoxib synergistically inhibit colon cancer cell proliferation via modulating Wnt/beta-catenin signaling pathway. Phytomedicine. 2021 Apr;84:153484.
Reference 110 Resveratrol enhances the antitumor effects of temozolomide in glioblastoma via ROS-dependent AMPK-TSC-mTOR signaling pathway. CNS Neurosci Ther. 2012 Jul;18(7):536-46.
Reference 111 [Inhibitory effect of sorafenib combined with arsenic trioxide on hepatocellular carcinoma cells]. Nan Fang Yi Ke Da Xue Xue Bao. 2008 Apr;28(4):639-41.
Reference 112 Synergistic apoptotic effect of celecoxib and luteolin on breast cancer cells. Oncol Rep. 2013 Feb;29(2):819-25.
Reference 113 Arsenic trioxide potentiates Gilteritinib-induced apoptosis in FLT3-ITD positive leukemic cells via IRE1a-JNK-mediated endoplasmic reticulum stress. Cancer Cell Int. 2020 Jun 17;20:250.
Reference 114 Combination of Tetrandrine with cisplatin enhances cytotoxicity through growth suppression and apoptosis in ovarian cancer in vitro and in vivo. Cancer Lett. 2011 May 1;304(1):21-32.
Reference 115 Impact of fixed-dose combination of germacrone, curdione, and furanodiene on breast cancer cell proliferation. Cell J. Summer 2013;15(2):160-5.
Reference 116 Synergistic effect of black tea polyphenol, theaflavin-3,3'-digallate with cisplatin against cisplatin resistant human ovarian cancer cells. J Funct Foods. 2018 Jul;46:1-11.
Reference 117 Metformin synergistic pemetrexed suppresses non-small-cell lung cancer cell proliferation and invasion in vitro. Cancer Med. 2017 Aug;6(8):1965-1975.
Reference 118 Inhibition of the autophagy flux by gingerol enhances TRAIL-induced tumor cell death. Oncol Rep. 2015 May;33(5):2331-6.
Reference 119 Combination of Poly I:C and arsenic trioxide triggers apoptosis synergistically via activation of TLR3 and mitochondrial pathways in hepatocellular carcinoma cells. Cell Biol Int. 2011 Aug;35(8):803-10.
Reference 120 Functional daidzein enhances the anticancer effect of topotecan and reverses BCRP-mediated drug resistance in breast cancer. Pharmacol Res. 2019 Sep;147:104387.
Reference 121 Synergistic anticancer activity of capsaicin and 3,3'-diindolylmethane in human colorectal cancer. J Agric Food Chem. 2015 May 6;63(17):4297-304.
Reference 122 Synergistic antitumor effect of brusatol combined with cisplatin on colorectal cancer cells. Int J Mol Med. 2018 Mar;41(3):1447-1454.
Reference 123 Capsaicin enhances the antitumor activity of sorafenib in hepatocellular carcinoma cells and mouse xenograft tumors through increased ERK signaling. Acta Pharmacol Sin. 2018 Mar;39(3):438-448.
Reference 124 Antitumor effects and the underlying mechanism of licochalcone A combined with 5-fluorouracil in gastric cancer cells. Oncol Lett. 2017 Mar;13(3):1695-1701.
Reference 125 Ursolic acid inhibits proliferation and reverses drug resistance of ovarian cancer stem cells by downregulating ABCG2 through suppressing the expression of hypoxia-inducible factor-1alpha in vitro. Oncol Rep. 2016 Jul;36(1):428-40.
Reference 126 Enhanced anticancer efficiency of doxorubicin against human glioma by natural borneol through triggering ROS-mediated signal. Biomed Pharmacother. 2019 Oct;118:109261.
Reference 127 Cryptotanshinone Protects Cartilage against Developing Osteoarthritis through the miR-106a-5p/GLIS3 Axis. Mol Ther Nucleic Acids. 2018 Jun 1;11:170-179.
Reference 128 Inhibitory effects of nobiletin on hepatocellular carcinoma in vitro and in vivo. Phytother Res. 2014 Apr;28(4):560-7.
Cite NPCDR
Visitor Map
Correspondence

X. N. Sun, Y. T. Zhang, Y. Zhou, X. C. Lian, L. L. Yan, T. Pan, T. Jin, H. Xie, Z. M. Liang, W. Q. Qiu, J. X. Wang, Z. R. Li, F. Zhu*, X. B. Sui*. NPCDR: natural product-based drug combination and its disease-specific molecular regulation. Nucleic Acids Research. 50(D1): 1324-1333 (2020). PMID: 34664659

Prof. Feng ZHU  (zhufeng@zju.edu.cn)

College of Pharmaceutical Sciences, Zhejiang University, Hangzhou, China


Prof. Xinbing SUI  (hzzju@hznu.edu.cn)

School of Pharmacy and Department of Medical Oncology, the Affiliated Hospital of Hangzhou Normal University, Hangzhou Normal University, Hangzhou, China