Skip to main content
  •   Home
  • 2026 Update 
    • Search for Activity
    • 2026 update
    • Search for Structure
    • 2026 update
  •   Download
  •   Manual

Molecule Details

General Information of the Molecule
Name
Poly [ADP-ribose] polymerase 1 (PARP1)
Synonyms
Protein poly-ADP-ribosyltransferase PARP1; Poly[ADP-ribose] synthetase-1; Poly[ADP-ribose] synthase 1; Poly(ADP-ribose)polymerase-1; PPOL; PARP-1; NAD(+)Poly [ADP-ribose] polymerase-1 ADP-ribosyltransferase-1; NAD(+) ADP-ribosyltransferase-1; NAD(+) ADP-ribosyltransferase 1; DNA ADP-ribosyltransferase PARP1; ARTD1; ADPRT 1; ADPRT; ADP-ribosyltransferase diphtheria toxin-like 1
Gene Name
PARP1
Gene ID
142
Sequence
MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKV
GHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKS
NRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQ
LKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKA
QNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSG
QLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPPE
TSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLT
GTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSP
WGAEVKAEPVEVVAPRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLE
HSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNK
LEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPG
TKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAV
SQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRG
GSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIE
REGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM
VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA
NISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW
    Click to Show/Hide
Function
Poly-ADP-ribosyltransferase that mediates poly-ADP-ribosylation of proteins and plays a key role in DNA repair. Mediates glutamate, aspartate, serine or tyrosine ADP-ribosylation of proteins: the ADP-D-ribosyl group of NAD(+) is transferred to the acceptor carboxyl group of target residues and further ADP-ribosyl groups are transferred to the 2'-position of the terminal adenosine moiety, building up a polymer with an average chain length of 20-30 units. Serine ADP-ribosylation of proteins constitutes the primary form of ADP-ribosylation of proteins in response to DNA damage. Mainly mediates glutamate and aspartate ADP-ribosylation of target proteins in absence of HPF1. Following interaction with HPF1, catalyzes serine ADP-ribosylation of target proteins; HPF1 conferring serine specificity by completing the PARP1 active site. Also catalyzes tyrosine ADP-ribosylation of target proteins following interaction with HPF1. PARP1 initiates the repair of DNA breaks: recognizes and binds DNA breaks within chromatin and recruits HPF1, licensing serine ADP-ribosylation of target proteins, such as histones, thereby promoting decompaction of chromatin and the recruitment of repair factors leading to the reparation of DNA strand breaks. In addition to base excision repair (BER) pathway, also involved in double-strand breaks (DSBs) repair: together with TIMELESS, accumulates at DNA damage sites and promotes homologous recombination repair by mediating poly-ADP-ribosylation. Mediates the poly(ADP-ribosyl)ation of a number of proteins, including itself, APLF and CHFR. In addition to proteins, also able to ADP-ribosylate DNA: catalyzes ADP-ribosylation of DNA strand break termini containing terminal phosphates and a 2'-OH group in single- and double-stranded DNA, respectively. Required for PARP9 and DTX3L recruitment to DNA damage sites. PARP1-dependent PARP9-DTX3L-mediated ubiquitination promotes the rapid and specific recruitment of 53BP1/TP53BP1, UIMC1/RAP80, and BRCA1 to DNA damage sites. Acts as a regulator of transcription: positively regulates the transcription of MTUS1 and negatively regulates the transcription of MTUS2/TIP150. Plays a role in the positive regulation of IFNG transcription in T-helper 1 cells as part of an IFNG promoter-binding complex with TXK and EEF1A1. Involved in the synthesis of ATP in the nucleus, together with NMNAT1, PARG and NUDT5. Nuclear ATP generation is required for extensive chromatin remodeling events that are energy-consuming.
    Click to Show/Hide
Uniprot ID
PARP1_HUMAN
EC Number
EC: 2.4.2.30 ; EC: 2.4.2.-
Pfam
PF00533 ; PF08063 ; PF00644 ; PF02877 ; PF05406 ; PF00645
KEGG ID
hsa142
TTD ID
T06273
A List of Drug Combination(s) Able to Regulate This Molecule
          Cleavage Regulation     Click to Show/Hide the Drug Combination Regulating This Molecule
                 Down-regulation     Click to Show/Hide
                    Drug Combination 1 Down-regulating the Cleavage of This Molecule [1]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Genistein   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 2 Down-regulating the Cleavage of This Molecule [2]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 3 Down-regulating the Cleavage of This Molecule [3]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Gambogic acid   NP Info  + TNF-related apoptosis inducing ligand    Drug Info 
                    Structure +
                 Up-regulation     Click to Show/Hide
                    Drug Combination 1 Up-regulating the Cleavage of This Molecule [15]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 2 Up-regulating the Cleavage of This Molecule [16]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Quercetin   NP Info  + Temozolomide   Drug Info 
                    Structure +
                    Drug Combination 3 Up-regulating the Cleavage of This Molecule [17]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Wogonin   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 4 Up-regulating the Cleavage of This Molecule [18]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumol   NP Info  + TNF-related apoptosis inducing ligand    Drug Info 
                    Structure +
                    Drug Combination 5 Up-regulating the Cleavage of This Molecule [19]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Polydatin   NP Info  + N-palmitoylethanolamine   Drug Info 
                    Structure +
                    Drug Combination 6 Up-regulating the Cleavage of This Molecule [20]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Silibinin   NP Info  + Indole-3-carbinol   Drug Info 
                    Structure +
                    Drug Combination 7 Up-regulating the Cleavage of This Molecule [21]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Resveratrol   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 8 Up-regulating the Cleavage of This Molecule [22]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Pterostilbene   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 9 Up-regulating the Cleavage of This Molecule [23]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Elemene   NP Info  + Etoposide   Drug Info 
                    Structure +
                    Drug Combination 10 Up-regulating the Cleavage of This Molecule [24]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Carnosic acid   NP Info  + Tamoxifen   Drug Info 
                    Structure +
                    Drug Combination 11 Up-regulating the Cleavage of This Molecule [25]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Betulinic Acid   NP Info  + Erlotinib   Drug Info 
                    Structure +
                    Drug Combination 12 Up-regulating the Cleavage of This Molecule [26]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Epigallocatechin gallate   NP Info  + Enoxacin   Drug Info 
                    Structure +
                    Drug Combination 13 Up-regulating the Cleavage of This Molecule [27]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name 6-shogaol   NP Info  + Gemcitabine   Drug Info 
                    Structure +
                    Drug Combination 14 Up-regulating the Cleavage of This Molecule [28]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Cinchonine + Hydrocinchonine + Quinidine
    Click to Show/Hide the Each NP or Drug Structure of This Combination
Cinchonine   NP Info     Drug Info 
   Drug Info 
                    Drug Combination 15 Up-regulating the Cleavage of This Molecule [29]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name 6-shogaol   NP Info  + TNF-related apoptosis inducing ligand    Drug Info 
                    Structure +
                    Drug Combination 16 Up-regulating the Cleavage of This Molecule [30]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Gambogic acid   NP Info  + Chloroquine   Drug Info 
                    Structure +
                    Drug Combination 17 Up-regulating the Cleavage of This Molecule [31]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Scutellarin   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 18 Up-regulating the Cleavage of This Molecule [32]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Dihydroartemisinin   NP Info  + Doxorubicin   Drug Info 
                    Structure +
                    Drug Combination 19 Up-regulating the Cleavage of This Molecule [33]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Apigenin   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 20 Up-regulating the Cleavage of This Molecule [34]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Apigenin   NP Info  + Gefitinib   Drug Info 
                    Structure +
                    Drug Combination 21 Up-regulating the Cleavage of This Molecule [4]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Gambogic acid   NP Info  + Doxorubicin   Drug Info 
                    Structure +
                    Drug Combination 22 Up-regulating the Cleavage of This Molecule [35]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + Docetaxel   Drug Info 
                    Structure +
                    Drug Combination 23 Up-regulating the Cleavage of This Molecule [36]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Wogonin   NP Info  + Sorafenib   Drug Info 
                    Structure +
                    Drug Combination 24 Up-regulating the Cleavage of This Molecule [37]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + 1,3-bis(2-chloroethyl)-1-nitrosourea   Drug Info 
                    Structure +
                    Drug Combination 25 Up-regulating the Cleavage of This Molecule [38]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Cucurbitacin B   NP Info  + Doxorubicin   Drug Info 
                    Structure +
                    Drug Combination 26 Up-regulating the Cleavage of This Molecule
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name luteolin   NP Info  + 5-Fluorouracil   Drug Info 
                    Drug Combination 27 Up-regulating the Cleavage of This Molecule [39]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Luteolin   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 28 Up-regulating the Cleavage of This Molecule [40]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Naringenin   NP Info  + ABT-737   Drug Info 
                    Structure +
                    Drug Combination 29 Up-regulating the Cleavage of This Molecule [41]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Silibinin   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 30 Up-regulating the Cleavage of This Molecule [42]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + Megestrol acetate   Drug Info 
                    Structure +
                    Drug Combination 31 Up-regulating the Cleavage of This Molecule [43]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Epigallocatechin gallate   NP Info  + TNF-related apoptosis inducing ligand    Drug Info 
                    Structure +
                    Drug Combination 32 Up-regulating the Cleavage of This Molecule [44]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Gossypol   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 33 Up-regulating the Cleavage of This Molecule [45]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + Bortezomib   Drug Info 
                    Structure +
                    Drug Combination 34 Up-regulating the Cleavage of This Molecule [46]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Tangeretin   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 35 Up-regulating the Cleavage of This Molecule [47]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + Dasatinib   Drug Info 
                    Structure +
                    Drug Combination 36 Up-regulating the Cleavage of This Molecule [48]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Epigallocatechin gallate   NP Info  + Bortezomib   Drug Info 
                    Structure +
                    Drug Combination 37 Up-regulating the Cleavage of This Molecule [49]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + Androgen   Drug Info 
                    Structure +
                    Drug Combination 38 Up-regulating the Cleavage of This Molecule [50]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + Busulfan   Drug Info 
                    Structure +
                    Drug Combination 39 Up-regulating the Cleavage of This Molecule [51]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Luteolin   NP Info  + IL-24   Drug Info 
                    Structure +
                    Drug Combination 40 Up-regulating the Cleavage of This Molecule [52]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Flavopiridol   NP Info  + Gemcitabine   Drug Info 
                    Structure +
                    Drug Combination 41 Up-regulating the Cleavage of This Molecule [53]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + Buthionine sulfoximine   Drug Info 
                    Structure +
                    Drug Combination 42 Up-regulating the Cleavage of This Molecule [54]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Oroxylin A   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 43 Up-regulating the Cleavage of This Molecule [55]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Elemene   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 44 Up-regulating the Cleavage of This Molecule [56]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + Fenretinide   Drug Info 
                    Structure +
                    Drug Combination 45 Up-regulating the Cleavage of This Molecule [57]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + Gemcitabine   Drug Info 
                    Structure +
                    Drug Combination 46 Up-regulating the Cleavage of This Molecule [58]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Resveratrol   NP Info  + Sorafenib   Drug Info 
                    Structure +
                    Drug Combination 47 Up-regulating the Cleavage of This Molecule [59]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Luteolin   NP Info  + Sorafenib   Drug Info 
                    Structure +
                    Drug Combination 48 Up-regulating the Cleavage of This Molecule [60]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + TNF-related apoptosis inducing ligand    Drug Info 
                    Structure +
                    Drug Combination 49 Up-regulating the Cleavage of This Molecule [61]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Resveratrol   NP Info  + Gemcitabine   Drug Info 
                    Structure +
                    Drug Combination 50 Up-regulating the Cleavage of This Molecule [62]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Vincristine   NP Info  + VE-465   Drug Info 
                    Structure +
                    Drug Combination 51 Up-regulating the Cleavage of This Molecule [63]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Epigallocatechin gallate   NP Info  + SU5416   Drug Info 
                    Structure +
                    Drug Combination 52 Up-regulating the Cleavage of This Molecule [64]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Kaempferol   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 53 Up-regulating the Cleavage of This Molecule [65]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + Tolfenamic acid   Drug Info 
                    Structure +
                    Drug Combination 54 Up-regulating the Cleavage of This Molecule [66]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Genistein   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 55 Up-regulating the Cleavage of This Molecule [2]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 56 Up-regulating the Cleavage of This Molecule [67]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Celastrol   NP Info  + TNF-related apoptosis inducing ligand    Drug Info 
                    Structure +
                    Drug Combination 57 Up-regulating the Cleavage of This Molecule [8]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Noscapine   NP Info  + Gemcitabine   Drug Info 
                    Structure +
                    Drug Combination 58 Up-regulating the Cleavage of This Molecule [68]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Apigenin   NP Info  + TNF-related apoptosis inducing ligand    Drug Info 
                    Structure +
                    Drug Combination 59 Up-regulating the Cleavage of This Molecule [69]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Resveratrol   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 60 Up-regulating the Cleavage of This Molecule [70]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Chrysin   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 61 Up-regulating the Cleavage of This Molecule [9]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + Everolimus   Drug Info 
                    Structure +
                    Drug Combination 62 Up-regulating the Cleavage of This Molecule [71]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + TNF-related apoptosis inducing ligand    Drug Info 
                    Structure +
                    Drug Combination 63 Up-regulating the Cleavage of This Molecule [72]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + Vorinostat   Drug Info 
                    Structure +
                    Drug Combination 64 Up-regulating the Cleavage of This Molecule [73]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + Valproic acid   Drug Info 
                    Structure +
                    Drug Combination 65 Up-regulating the Cleavage of This Molecule [74]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Bufalin   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 66 Up-regulating the Cleavage of This Molecule [75]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Gambogic acid   NP Info  + MG262   Drug Info 
                    Structure +
                    Drug Combination 67 Up-regulating the Cleavage of This Molecule [76]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Vincristine   NP Info  + Sildenafil   Drug Info 
                    Structure +
                    Drug Combination 68 Up-regulating the Cleavage of This Molecule [77]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Eugenol   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 69 Up-regulating the Cleavage of This Molecule [25]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Betulinic Acid   NP Info  + Gefitinib   Drug Info 
                    Structure +
                    Drug Combination 70 Up-regulating the Cleavage of This Molecule [78]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + PD98059   Drug Info 
                    Structure +
                    Drug Combination 71 Up-regulating the Cleavage of This Molecule [79]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + Thioridazine   Drug Info 
                    Structure +
                    Drug Combination 72 Up-regulating the Cleavage of This Molecule [80]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Pterostilbene   NP Info  + Sorafenib   Drug Info 
                    Structure +
                    Drug Combination 73 Up-regulating the Cleavage of This Molecule [81]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Wogonin   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 74 Up-regulating the Cleavage of This Molecule [82]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Celastrol   NP Info  + ABT-737   Drug Info 
                    Structure +
                    Drug Combination 75 Up-regulating the Cleavage of This Molecule [83]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Genistein   NP Info  + Cabazitaxel   Drug Info 
                    Structure +
                    Drug Combination 76 Up-regulating the Cleavage of This Molecule [84]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Noscapine   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 77 Up-regulating the Cleavage of This Molecule [75]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Gambogic acid   NP Info  + MG132   Drug Info 
                    Structure +
                    Drug Combination 78 Up-regulating the Cleavage of This Molecule [85]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Epigallocatechin gallate   NP Info  + Doxorubicin   Drug Info 
                    Structure +
                    Drug Combination 79 Up-regulating the Cleavage of This Molecule [86]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Deguelin   NP Info  + AG1478   Drug Info 
                    Structure +
                    Drug Combination 80 Up-regulating the Cleavage of This Molecule [87]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Flavopiridol   NP Info  + TNF-related apoptosis inducing ligand    Drug Info 
                    Structure +
                    Drug Combination 81 Up-regulating the Cleavage of This Molecule [88]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Flavopiridol   NP Info  + Imatinib   Drug Info 
                    Structure +
                    Drug Combination 82 Up-regulating the Cleavage of This Molecule [89]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Cladribine   NP Info  + S3I-201   Drug Info 
                    Structure +
                    Drug Combination 83 Up-regulating the Cleavage of This Molecule [90]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Gambogic acid   NP Info  + Gemcitabine   Drug Info 
                    Structure +
                    Drug Combination 84 Up-regulating the Cleavage of This Molecule [91]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Gamma tocotrienol + Atorvastatin + Celecoxib
    Click to Show/Hide the Each NP or Drug Structure of This Combination
Gamma tocotrienol   NP Info     Drug Info 
   Drug Info 
                    Drug Combination 85 Up-regulating the Cleavage of This Molecule [92]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Resveratrol   NP Info  + TNF-related apoptosis inducing ligand    Drug Info 
                    Structure +
                    Drug Combination 86 Up-regulating the Cleavage of This Molecule [78]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + PD184352   Drug Info 
                    Structure +
                    Drug Combination 87 Up-regulating the Cleavage of This Molecule [93]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Piperine   NP Info  + Celecoxib   Drug Info 
                    Structure +
                    Drug Combination 88 Up-regulating the Cleavage of This Molecule [94]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Epigallocatechin gallate   NP Info  + Erlotinib   Drug Info 
                    Structure +
                    Drug Combination 89 Up-regulating the Cleavage of This Molecule [95]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Carnosic acid   NP Info  + Temozolomide   Drug Info 
                    Structure +
                    Drug Combination 90 Up-regulating the Cleavage of This Molecule [96]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Luteolin   NP Info  + CD55-TRAIL   Drug Info 
                    Structure +
                    Drug Combination 91 Up-regulating the Cleavage of This Molecule [97]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Tetrandrine   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 92 Up-regulating the Cleavage of This Molecule [98]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + Trichostatin A   Drug Info 
                    Structure +
                    Drug Combination 93 Up-regulating the Cleavage of This Molecule [99]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Gingerol   NP Info  + TNF-related apoptosis inducing ligand    Drug Info 
                    Structure +
                    Drug Combination 94 Up-regulating the Cleavage of This Molecule [100]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + Etoposide   Drug Info 
                    Structure +
                    Drug Combination 95 Up-regulating the Cleavage of This Molecule [101]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + PD173074   Drug Info 
                    Structure +
                    Drug Combination 96 Up-regulating the Cleavage of This Molecule [102]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Luteolin   NP Info  + TNF-related apoptosis inducing ligand    Drug Info 
                    Structure +
                    Drug Combination 97 Up-regulating the Cleavage of This Molecule [103]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Ursolic acid   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 98 Up-regulating the Cleavage of This Molecule [104]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Resveratrol   NP Info  + Rapamycin   Drug Info 
                    Structure +
                    Drug Combination 99 Up-regulating the Cleavage of This Molecule [105]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Borneol   NP Info  + Doxorubicin   Drug Info 
                    Structure +
                    Drug Combination 100 Up-regulating the Cleavage of This Molecule [106]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Luteolin   NP Info  + SMC3   Drug Info 
                    Structure +
                    Drug Combination 101 Up-regulating the Cleavage of This Molecule [107]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Garcinol   NP Info  + Cisplatin   Drug Info 
                    Structure +
          Expression Regulation     Click to Show/Hide the Drug Combination Regulating This Molecule
                 Down-regulation     Click to Show/Hide
                    Drug Combination 1 Down-regulating the Expression of This Molecule [4]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Gambogic acid   NP Info  + Doxorubicin   Drug Info 
                    Structure +
                    Drug Combination 2 Down-regulating the Expression of This Molecule [5]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Withaferin A   NP Info  + Sorafenib   Drug Info 
                    Structure +
                    Drug Combination 3 Down-regulating the Expression of This Molecule [6]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Wogonin   NP Info  + TNF-related apoptosis inducing ligand    Drug Info 
                    Structure +
                    Drug Combination 4 Down-regulating the Expression of This Molecule [7]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Triptolide   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 5 Down-regulating the Expression of This Molecule [8]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Noscapine   NP Info  + Gemcitabine   Drug Info 
                    Structure +
                    Drug Combination 6 Down-regulating the Expression of This Molecule [9]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Arsenic trioxide   NP Info  + Everolimus   Drug Info 
                    Structure +
                    Drug Combination 7 Down-regulating the Expression of This Molecule [10]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Chrysin   NP Info  + TNF-related apoptosis inducing ligand    Drug Info 
                    Structure +
                    Drug Combination 8 Down-regulating the Expression of This Molecule [11]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Metformin   NP Info  + Olaparib   Drug Info 
                    Structure +
                    Drug Combination 9 Down-regulating the Expression of This Molecule [12]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Gambogic acid   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                 Up-regulation     Click to Show/Hide
                    Drug Combination 1 Up-regulating the Expression of This Molecule [108]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Bufalin   NP Info  + Sorafenib   Drug Info 
                    Structure +
                    Drug Combination 2 Up-regulating the Expression of This Molecule [109]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Sulforaphane   NP Info  + Acetazolamide   Drug Info 
                    Structure +
                    Drug Combination 3 Up-regulating the Expression of This Molecule [110]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Noscapine + Temozolomide + Bis-chloroethylnitrosourea + Cisplatin
    Click to Show/Hide the Each NP or Drug Structure of This Combination
Noscapine   NP Info     Drug Info 
   Drug Info 
   Drug Info 
                    Drug Combination 4 Up-regulating the Expression of This Molecule [111]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Fisetin   NP Info  + Sorafenib   Drug Info 
                    Structure +
                    Drug Combination 5 Up-regulating the Expression of This Molecule [112]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Triptolide   NP Info  + AMD3100   Drug Info 
                    Structure +
                    Drug Combination 6 Up-regulating the Expression of This Molecule [113]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Triptolide   NP Info  + Venetoclax   Drug Info 
                    Structure +
                    Drug Combination 7 Up-regulating the Expression of This Molecule [114]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Triptolide   NP Info  + Tumor necrosis factor alpha   Drug Info 
                    Structure +
                    Drug Combination 8 Up-regulating the Expression of This Molecule [115]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Fisetin   NP Info  + Cabazitaxel   Drug Info 
                    Structure +
                    Drug Combination 9 Up-regulating the Expression of This Molecule [116]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Piperine   NP Info  + Mitomycin C   Drug Info 
                    Structure +
                    Drug Combination 10 Up-regulating the Expression of This Molecule [117]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Methylglyoxal   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 11 Up-regulating the Expression of This Molecule [7]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Triptolide   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 12 Up-regulating the Expression of This Molecule [118]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Salicylic acid   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 13 Up-regulating the Expression of This Molecule [119]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Osthole   NP Info  + TNF-related apoptosis inducing ligand    Drug Info 
                    Structure +
                    Drug Combination 14 Up-regulating the Expression of This Molecule [70]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Chrysin   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 15 Up-regulating the Expression of This Molecule [120]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Sulforaphane   NP Info  + TNF-related apoptosis inducing ligand    Drug Info 
                    Structure +
                    Drug Combination 16 Up-regulating the Expression of This Molecule [80]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Pterostilbene   NP Info  + Sorafenib   Drug Info 
                    Structure +
                    Drug Combination 17 Up-regulating the Expression of This Molecule [121]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Curcumin   NP Info  + Oxaliplatin   Drug Info 
                    Structure +
                    Drug Combination 18 Up-regulating the Expression of This Molecule [122]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Elemene   NP Info  + TNF-related apoptosis inducing ligand    Drug Info 
                    Structure +
                    Drug Combination 19 Up-regulating the Expression of This Molecule [123]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Sulforaphane   NP Info  + Imatinib   Drug Info 
                    Structure +
                    Drug Combination 20 Up-regulating the Expression of This Molecule [124]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Sulforaphane   NP Info  + Cisplatin   Drug Info 
                    Structure +
                    Drug Combination 21 Up-regulating the Expression of This Molecule [125]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Sulforaphane   NP Info  + Oxaliplatin   Drug Info 
                    Structure +
                    Drug Combination 22 Up-regulating the Expression of This Molecule [126]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Triptolide   NP Info  + Temozolomide   Drug Info 
                    Structure +
                    Drug Combination 23 Up-regulating the Expression of This Molecule [127]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Celastrol   NP Info  + TRAIL/Apo2L    Drug Info 
                    Structure +
                    Drug Combination 24 Up-regulating the Expression of This Molecule [128]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Vincristine   NP Info  + Vorinostat   Drug Info 
                    Structure +
                    Drug Combination 25 Up-regulating the Expression of This Molecule [129]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Capsaicin   NP Info  + Sorafenib   Drug Info 
                    Structure +
                    Drug Combination 26 Up-regulating the Expression of This Molecule [130]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Phytosphingosine   NP Info  + Gamma-ray irradiation   Drug Info 
                    Structure +
          Activity Regulation     Click to Show/Hide the Drug Combination Regulating This Molecule
                 Up-regulation     Click to Show/Hide
                    Drug Combination 1 Up-regulating the Activity of This Molecule [13]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Epigallocatechin gallate   NP Info  + 5-fluorouracil   Drug Info 
                    Structure +
                    Drug Combination 2 Up-regulating the Activity of This Molecule [14]
                    Detail(s)  Combination Info  click to show the detail info of this combination
                    Name Genistein   NP Info  + Centchroman   Drug Info 
                    Structure +
Natural Product(s) of This Target
1 Nicotinamide  NP Info  Approved Arabidopsis thaliana
References
Reference 1 Synergistic action of genistein and cisplatin on growth inhibition and cytotoxicity of human medulloblastoma cells. Pediatr Neurosurg. 2000 Sep;33(3):123-31.
Reference 2 Co-application of arsenic trioxide (As2O3) and cisplatin (CDDP) on human SY-5Y neuroblastoma cells has differential effects on the intracellular calcium concentration ([Ca2+]i) and cytotoxicity. Neurotoxicology. 2009 Mar;30(2):194-202.
Reference 3 Gambogic acid sensitizes breast cancer cells to TRAIL-induced apoptosis by promoting the crosstalk of extrinsic and intrinsic apoptotic signalings. Food Chem Toxicol. 2018 Sep;119:334-341.
Reference 4 Suppression of NF-KappaB signaling and P-glycoprotein function by gambogic acid synergistically potentiates adriamycin -induced apoptosis in lung cancer. Curr Cancer Drug Targets. 2014;14(1):91-103.
Reference 5 A novel combination of withaferin A and sorafenib shows synergistic efficacy against both papillary and anaplastic thyroid cancers. Am J Surg. 2012 Dec;204(6):895-900; discussion 900-1.
Reference 6 Reactive oxygen species up-regulate p53 and Puma; a possible mechanism for apoptosis during combined treatment with TRAIL and wogonin. Br J Pharmacol. 2009 Aug;157(7):1189-202.
Reference 7 Triptolide sensitizes cisplatin-resistant human epithelial ovarian cancer by inhibiting the phosphorylation of AKT. J Cancer. 2019 Jun 2;10(13):3012-3020.
Reference 8 Enhanced anticancer activity of gemcitabine in combination with noscapine via antiangiogenic and apoptotic pathway against non-small cell lung cancer. PLoS One. 2011;6(11):e27394.
Reference 9 Arsenic trioxide synergizes with everolimus (Rad001) to induce cytotoxicity of ovarian cancer cells through increased autophagy and apoptosis. Endocr Relat Cancer. 2012 Sep 21;19(5):711-23.
Reference 10 Chrysin promotes tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL) induced apoptosis in human cancer cell lines. Toxicol In Vitro. 2011 Apr;25(3):630-5.
Reference 11 Preclinical evaluation of olaparib and metformin combination in BRCA1 wildtype ovarian cancer. Gynecol Oncol. 2016 Aug;142(2):323-31.
Reference 12 Synergistic effect of 5-fluorouracil with gambogic acid on BGC-823 human gastric carcinoma. Toxicology. 2009 Feb 4;256(1-2):135-40.
Reference 13 Reversal of 5-fluorouracil resistance by EGCG is mediate by inactivation of TFAP2A/VEGF signaling pathway and down-regulation of MDR-1 and P-gp expression in gastric cancer. Oncotarget. 2017 Sep 6;8(47):82842-82853.
Reference 14 Genistein synergizes centchroman action in human breast cancer cells. Indian J Pharmacol. Nov-Dec 2016;48(6):637-642.
Reference 15 Curcumin enhances cytotoxicity of chemotherapeutic agents in prostate cancer cells by inducing p21(WAF1/CIP1) and C/EBPbeta expressions and suppressing NF-kappaB activation. Prostate. 2002 May 15;51(3):211-8.
Reference 16 Quercetin abrogates chemoresistance in melanoma cells by modulating deltaNp73. BMC Cancer. 2010 Jun 11;10:282.
Reference 17 Wogonin potentiates the antitumor effects of low dose 5-fluorouracil against gastric cancer through induction of apoptosis by down-regulation of NF-kappaB and regulation of its metabolism. Toxicol Lett. 2010 Sep 1;197(3):201-10.
Reference 18 Curcumol Overcomes TRAIL Resistance of Non-Small Cell Lung Cancer by Targeting NRH:Quinone Oxidoreductase 2 (NQO2). Adv Sci (Weinh). 2020 Oct 15;7(22):2002306.
Reference 19 Palmitoylethanolamide and Polydatin combination reduces inflammation and oxidative stress in vascular injury. Pharmacol Res. 2017 Sep;123:83-92.
Reference 20 Enhanced inhibition of lung adenocarcinoma by combinatorial treatment with indole-3-carbinol and silibinin in A/J mice. Carcinogenesis. 2011 Apr;32(4):561-7.
Reference 21 Effect of resveratrol and in combination with 5-FU on murine liver cancer. World J Gastroenterol. 2004 Oct 15;10(20):3048-52.
Reference 22 Pterostilbine, an active component of blueberries, sensitizes colon cancer cells to 5-fluorouracil cytotoxicity. Sci Rep. 2015 Oct 16;5:15239.
Reference 23 Synergistic antitumor effect of Beta-elemene and etoposide is mediated via induction of cell apoptosis and cell cycle arrest in non-small cell lung carcinoma cells. Mol Med Rep. Nov-Dec 2011;4(6):1189-93.
Reference 24 Carnosic acid cooperates with tamoxifen to induce apoptosis associated with Caspase-3 activation in breast cancer cells in vitro and in vivo. Biomed Pharmacother. 2017 May;89:827-837.
Reference 25 Effects and mechanisms of betulinic acid on improving EGFR TKI-resistance of lung cancer cells. Environ Toxicol. 2018 Nov;33(11):1153-1159.
Reference 26 Enoxacin and Epigallocatechin Gallate (EGCG) Act Synergistically to Inhibit the Growth of Cervical Cancer Cells in Culture. Molecules. 2019 Apr 22;24(8):1580.
Reference 27 Antitumor activity of gemcitabine can be potentiated in pancreatic cancer through modulation of TLR4/NF-kappaB signaling by 6-shogaol. AAPS J. 2014 Mar;16(2):246-57.
Reference 28 Hydrocinchonine, cinchonine, and quinidine potentiate paclitaxel-induced cytotoxicity and apoptosis via multidrug resistance reversal in MES-SA/DX5 uterine sarcoma cells. Environ Toxicol. 2011 Aug;26(4):424-31.
Reference 29 6-Shogaol enhances renal carcinoma Caki cells to TRAIL-induced apoptosis through reactive oxygen species-mediated cytochrome c release and down-regulation of c-FLIP(L) expression. Chem Biol Interact. 2015 Feb 25;228:69-78.
Reference 30 Gambogic acid induces autophagy and combines synergistically with chloroquine to suppress pancreatic cancer by increasing the accumulation of reactive oxygen species. Cancer Cell Int. 2019 Jan 5;19:7.
Reference 31 Scutellarin Increases Cisplatin-Induced Apoptosis and Autophagy to Overcome Cisplatin Resistance in Non-small Cell Lung Cancer via ERK/p53 and c-met/AKT Signaling Pathways. Front Pharmacol. 2018 Feb 13;9:92.
Reference 32 Synergistic anti-cancer activity of the combination of dihydroartemisinin and doxorubicin in breast cancer cells. Pharmacol Rep. 2013;65(2):453-9.
Reference 33 5-Fluorouracil combined with apigenin enhances anticancer activity through induction of apoptosis in human breast cancer MDA-MB-453 cells. Oncol Rep. 2009 Dec;22(6):1533-7.
Reference 34 Apigenin Combined With Gefitinib Blocks Autophagy Flux and Induces Apoptotic Cell Death Through Inhibition of HIF-1alpha, c-Myc, p-EGFR, and Glucose Metabolism in EGFR L858R+T790M-Mutated H1975 Cells. Front Pharmacol. 2019 Mar 22;10:260.
Reference 35 Curcumin enhances anti?cancer efficacy of either gemcitabine or docetaxel on pancreatic cancer cells. Oncol Rep. 2020 Oct;44(4):1393-1402.
Reference 36 Combination of wogonin and sorafenib effectively kills human hepatocellular carcinoma cells through apoptosis potentiation and autophagy inhibition. Oncol Lett. 2017 Jun;13(6):5028-5034.
Reference 37 Combination of arsenic trioxide and BCNU synergistically triggers redox-mediated autophagic cell death in human solid tumors. Free Radic Biol Med. 2011 Dec 15;51(12):2195-209.
Reference 38 Doxorubicin has a synergistic cytotoxicity with cucurbitacin B in anaplastic thyroid carcinoma cells. Tumour Biol. 2017 Feb;39(2):1010428317692252.
Reference 39 Luteolin synergizes the antitumor effects of 5-fluorouracil against human hepatocellular carcinoma cells through apoptosis induction and metabolism. Life Sci. 2016 Jan 1;144:138-47.
Reference 40 Enhanced anticancer effect of ABT-737 in combination with naringenin on gastric cancer cells. Exp Ther Med. 2016 Feb;11(2):669-673.
Reference 41 Silibinin sensitizes human prostate carcinoma DU145 cells to cisplatin- and carboplatin-induced growth inhibition and apoptotic death. Int J Cancer. 2003 Sep 20;106(5):699-705.
Reference 42 Enhanced antitumor activity of combined megestrol acetate and arsenic trioxide treatment in liver cancer cells. Exp Ther Med. 2018 Apr;15(4):4047-4055.
Reference 43 Green tea polyphenol EGCG sensitizes human prostate carcinoma LNCaP cells to TRAIL-mediated apoptosis and synergistically inhibits biomarkers associated with angiogenesis and metastasis. Oncogene. 2008 Mar 27;27(14):2055-63.
Reference 44 Gossypol sensitizes the antitumor activity of 5-FU through down-regulation of thymidylate synthase in human colon carcinoma cells. Cancer Chemother Pharmacol. 2015 Sep;76(3):575-86.
Reference 45 Rationale and efficacy of proteasome inhibitor combined with arsenic trioxide in the treatment of acute promyelocytic leukemia. Leukemia. 2016 Nov;30(11):2169-2178.
Reference 46 Synergistic therapy with tangeretin and 5-fluorouracil accelerates the ROS/JNK mediated apoptotic pathway in human colorectal cancer cell. Food Chem Toxicol. 2020 Sep;143:111529.
Reference 47 Combination of arsenic trioxide and Dasatinib: a new strategy to treat Philadelphia chromosome-positive acute lymphoblastic leukaemia. J Cell Mol Med. 2018 Mar;22(3):1614-1626.
Reference 48 Potentiation of (-)-epigallocatechin-3-gallate-induced apoptosis by bortezomib in multiple myeloma cells. Acta Biochim Biophys Sin (Shanghai). 2009 Dec;41(12):1018-26.
Reference 49 Arsenic trioxide enhances the radiation sensitivity of androgen-dependent and -independent human prostate cancer cells. PLoS One. 2012;7(2):e31579.
Reference 50 Curcumin Enhanced Busulfan-Induced Apoptosis through Downregulating the Expression of Survivin in Leukemia Stem-Like KG1a Cells. Biomed Res Int. 2015;2015:630397.
Reference 51 Luteolin enhances the antitumor efficacy of oncolytic vaccinia virus that harbors IL-24 gene in liver cancer cells. J Clin Lab Anal. 2021 Mar;35(3):e23677.
Reference 52 Flavopiridol increases sensitization to gemcitabine in human gastrointestinal cancer cell lines and correlates with down-regulation of ribonucleotide reductase M2 subunit. Clin Cancer Res. 2001 Aug;7(8):2527-36.
Reference 53 Arsenic trioxide-induced apoptosis and its enhancement by buthionine sulfoximine in hepatocellular carcinoma cell lines. Biochem Biophys Res Commun. 2002 Mar 8;291(4):861-7.
Reference 54 Synergistic effect of 5-fluorouracil and the flavanoid oroxylin A on HepG2 human hepatocellular carcinoma and on H22 transplanted mice. Cancer Chemother Pharmacol. 2010 Feb;65(3):481-9.
Reference 55 beta-Elemene, a novel plant-derived antineoplastic agent, increases cisplatin chemosensitivity of lung tumor cells by triggering apoptosis. Oncol Rep. 2009 Jul;22(1):161-70.
Reference 56 Synergistic effect of fenretinide and curcumin for treatment of non-small cell lung cancer. Cancer Biol Ther. 2016 Oct 2;17(10):1022-1029.
Reference 57 Curcumin potentiates antitumor activity of gemcitabine in an orthotopic model of pancreatic cancer through suppression of proliferation, angiogenesis, and inhibition of nuclear factor-kappaB-regulated gene products. Cancer Res. 2007 Apr 15;67(8):3853-61.
Reference 58 Resveratrol enhances the efficacy of sorafenib mediated apoptosis in human breast cancer MCF7 cells through ROS, cell cycle inhibition, caspase 3 and PARP cleavage. Biomed Pharmacother. 2016 Dec;84:1906-1914.
Reference 59 Luteolin and sorafenib combination kills human hepatocellular carcinoma cells through apoptosis potentiation and JNK activation. Oncol Lett. 2018 Jul;16(1):648-653.
Reference 60 TRAIL sensitisation by arsenic trioxide is caspase-8 dependent and involves modulation of death receptor components and Akt. Br J Cancer. 2006 Feb 13;94(3):398-406.
Reference 61 Resveratrol, a multitargeted agent, can enhance antitumor activity of gemcitabine in vitro and in orthotopic mouse model of human pancreatic cancer. Int J Cancer. 2010 Jul 15;127(2):257-68.
Reference 62 Vincristine potentiates the anti-proliferative effect of an aurora kinase inhibitor, VE-465, in myeloid leukemia cells. Biochem Pharmacol. 2011 Dec 15;82(12):1884-90.
Reference 63 SU5416 and EGCG work synergistically and inhibit angiogenic and survival factors and induce cell cycle arrest to promote apoptosis in human malignant neuroblastoma SH-SY5Y and SK-N-BE2 cells. Neurochem Res. 2011 Aug;36(8):1383-96.
Reference 64 Kaempferol enhances cisplatin's effect on ovarian cancer cells through promoting apoptosis caused by down regulation of cMyc. Cancer Cell Int. 2010 May 11;10:16.
Reference 65 Combination of tolfenamic acid and curcumin induces colon cancer cell growth inhibition through modulating specific transcription factors and reactive oxygen species. Oncotarget. 2016 Jan 19;7(3):3186-200.
Reference 66 Combination of 5-fluorouracil and genistein induces apoptosis synergistically in chemo-resistant cancer cells through the modulation of AMPK and COX-2 signaling pathways. Biochem Biophys Res Commun. 2005 Jul 1;332(2):433-40.
Reference 67 Autophagy flux inhibition mediated by celastrol sensitized lung cancer cells to TRAIL?induced apoptosis via regulation of mitochondrial transmembrane potential and reactive oxygen species. Mol Med Rep. 2019 Feb;19(2):984-993.
Reference 68 Ethanolic Extract of Propolis Augments TRAIL-Induced Apoptotic Death in Prostate Cancer Cells. Evid Based Complement Alternat Med. 2011;2011:535172.
Reference 69 Resveratrol Enhances Chemosensitivity in Mouse Melanoma Model Through Connexin 43 Upregulation. Environ Toxicol. 2015 Jul 8;30(8):877-86.
Reference 70 Combination of chrysin and cisplatin promotes the apoptosis of Hep G2 cells by up-regulating p53. Chem Biol Interact. 2015 May 5;232:12-20.
Reference 71 Curcumin sensitizes tumor necrosis factor-related apoptosis-inducing ligand (TRAIL)-induced apoptosis through reactive oxygen species-mediated upregulation of death receptor 5 (DR5). Carcinogenesis. 2005 Nov;26(11):1905-13.
Reference 72 Enhanced suppression of tumor growth by concomitant treatment of human lung cancer cells with suberoylanilide hydroxamic acid and arsenic trioxide. Toxicol Appl Pharmacol. 2011 Nov 15;257(1):59-66.
Reference 73 Synergistic effects of valproic acid and arsenic trioxide on RPMI8226 cells in vitro and the possible underlying mechanisms. Mol Med Rep. 2015 Jul;12(1):1449-56.
Reference 74 Bufalin and 5-fluorouracil synergistically induce apoptosis in colorectal cancer cells. Oncol Lett. 2018 May;15(5):8019-8026.
Reference 75 Gambogic acid enhances proteasome inhibitor-induced anticancer activity. Cancer Lett. 2011 Feb 28;301(2):221-8.
Reference 76 Phosphodiesterase Type 5 Inhibitors Synergize Vincristine in Killing Castration-Resistant Prostate Cancer Through Amplifying Mitotic Arrest Signaling. Front Oncol. 2020 Aug 7;10:1274.
Reference 77 Eugenol potentiates cisplatin anti-cancer activity through inhibition of ALDH-positive breast cancer stem cells and the NF-kappaB signaling pathway. Mol Carcinog. 2018 Mar;57(3):333-346.
Reference 78 Treatment with arsenic trioxide (ATO) and MEK1 inhibitor activates the p73-p53AIP1 apoptotic pathway in leukemia cells. Blood. 2004 Jul 15;104(2):519-25.
Reference 79 NOX4-mediated ROS production induces apoptotic cell death via down-regulation of c-FLIP and Mcl-1 expression in combined treatment with thioridazine and curcumin. Redox Biol. 2017 Oct;13:608-622.
Reference 80 Pterostilbene enhances sorafenib's anticancer effects on gastric adenocarcinoma. J Cell Mol Med. 2020 Nov;24(21):12525-12536.
Reference 81 Wogonin potentiates cisplatin-induced cancer cell apoptosis through accumulation of intracellular reactive oxygen species. Oncol Rep. 2012 Aug;28(2):601-5.
Reference 82 Upregulating Noxa by ER stress, celastrol exerts synergistic anti-cancer activity in combination with ABT-737 in human hepatocellular carcinoma cells. PLoS One. 2012;7(12):e52333.
Reference 83 Genistein enhances the efficacy of cabazitaxel chemotherapy in metastatic castration-resistant prostate cancer cells. Prostate. 2013 Nov;73(15):1681-9.
Reference 84 Noscapine sensitizes chemoresistant ovarian cancer cells to cisplatin through inhibition of HIF-1Alpha. Cancer Lett. 2011 Jun 1;305(1):94-9.
Reference 85 In vivo reversal of doxorubicin resistance by (-)-epigallocatechin gallate in a solid human carcinoma xenograft. Cancer Lett. 2004 May 28;208(2):179-86.
Reference 86 Deguelin Potentiates Apoptotic Activity of an EGFR Tyrosine Kinase Inhibitor (AG1478) in PIK3CA-Mutated Head and Neck Squamous Cell Carcinoma. Int J Mol Sci. 2017 Jan 26;18(2):262.
Reference 87 Flavopiridol induces cellular FLICE-inhibitory protein degradation by the proteasome and promotes TRAIL-induced early signaling and apoptosis in breast tumor cells. Cancer Res. 2006 Sep 1;66(17):8858-69.
Reference 88 Flavopiridol potentiates STI571-induced mitochondrial damage and apoptosis in BCR-ABL-positive human leukemia cells. Clin Cancer Res. 2002 Sep;8(9):2976-84.
Reference 89 Therapeutic potential of cladribine in combination with STAT3 inhibitor against multiple myeloma. BMC Cancer. 2011 Jun 16;11:255.
Reference 90 Gambogic acid potentiates gemcitabine induced anticancer activity in non-small cell lung cancer. Eur J Pharmacol. 2020 Dec 5;888:173486.
Reference 91 Synergistic actions of atorvastatin with gamma-tocotrienol and celecoxib against human colon cancer HT29 and HCT116 cells. Int J Cancer. 2010 Feb 15;126(4):852-63.
Reference 92 Resveratrol sensitizes androgen independent prostate cancer cells to death-receptor mediated apoptosis through multiple mechanisms. Prostate. 2007 Nov 1;67(15):1641-53.
Reference 93 Piperine and Celecoxib synergistically inhibit colon cancer cell proliferation via modulating Wnt/beta-catenin signaling pathway. Phytomedicine. 2021 Apr;84:153484.
Reference 94 Synergistic inhibition of head and neck tumor growth by green tea (-)-epigallocatechin-3-gallate and EGFR tyrosine kinase inhibitor. Int J Cancer. 2008 Sep 1;123(5):1005-14.
Reference 95 Carnosic acid potentiates the anticancer effect of temozolomide by inducing apoptosis and autophagy in glioma. J Neurooncol. 2019 Jan;141(2):277-288.
Reference 96 Combination of oncolytic adenovirus and luteolin exerts synergistic antitumor effects in colorectal cancer cells and a mouse model. Mol Med Rep. 2017 Dec;16(6):9375-9382.
Reference 97 Combination of Tetrandrine with cisplatin enhances cytotoxicity through growth suppression and apoptosis in ovarian cancer in vitro and in vivo. Cancer Lett. 2011 May 1;304(1):21-32.
Reference 98 Curcumin enhances the anticancer effects of trichostatin a in breast cancer cells. Mol Carcinog. 2013 May;52(5):404-11.
Reference 99 Inhibition of the autophagy flux by gingerol enhances TRAIL-induced tumor cell death. Oncol Rep. 2015 May;33(5):2331-6.
Reference 100 Arsenic trioxide potentiates the effectiveness of etoposide in Ewing sarcomas. Int J Oncol. 2016 Nov;49(5):2135-2146.
Reference 101 Combination effects of arsenic trioxide and fibroblast growth factor receptor inhibitor in squamous cell lung carcinoma. Lung Cancer. 2016 Nov;101:111-119.
Reference 102 The combination of TRAIL and luteolin enhances apoptosis in human cervical cancer HeLa cells. Biochem Biophys Res Commun. 2005 Aug 5;333(3):833-8.
Reference 103 Ursolic acid inhibits proliferation and reverses drug resistance of ovarian cancer stem cells by downregulating ABCG2 through suppressing the expression of hypoxia-inducible factor-1alpha in vitro. Oncol Rep. 2016 Jul;36(1):428-40.
Reference 104 Resveratrol enhances the anti-tumor activity of the mTOR inhibitor rapamycin in multiple breast cancer cell lines mainly by suppressing rapamycin-induced AKT signaling. Cancer Lett. 2011 Feb 28;301(2):168-76.
Reference 105 Enhanced anticancer efficiency of doxorubicin against human glioma by natural borneol through triggering ROS-mediated signal. Biomed Pharmacother. 2019 Oct;118:109261.
Reference 106 Attenuating Smac mimetic compound 3-induced NF-kappaB activation by luteolin leads to synergistic cytotoxicity in cancer cells. J Cell Biochem. 2009 Dec 1;108(5):1125-31.
Reference 107 Garcinol Alone and in Combination With Cisplatin Affect Cellular Behavior and PI3K/AKT Protein Phosphorylation in Human Ovarian Cancer Cells. Dose Response. 2020 May 19;18(2):1559325820926732.
Reference 108 Bufalin enhances the anti-proliferative effect of sorafenib on human hepatocellular carcinoma cells through downregulation of ERK. Mol Biol Rep. 2012 Feb;39(2):1683-9.
Reference 109 Simultaneous Targeting of Bladder Tumor Growth, Survival, and Epithelial-to-Mesenchymal Transition with a Novel Therapeutic Combination of Acetazolamide (AZ) and Sulforaphane (SFN). Target Oncol. 2016 Apr;11(2):209-27.
Reference 110 Synergistic suppression of noscapine and conventional chemotherapeutics on human glioblastoma cell growth. Acta Pharmacol Sin. 2013 Jul;34(7):930-8.
Reference 111 Fisetin, a phytochemical, potentiates sorafenib-induced apoptosis and abrogates tumor growth in athymic nude mice implanted with BRAF-mutated melanoma cells. Oncotarget. 2015 Sep 29;6(29):28296-311.
Reference 112 AMD3100 combined with triptolide inhibit proliferation, invasion and metastasis and induce apoptosis of human U2OS osteosarcoma cells. Biomed Pharmacother. 2017 Feb;86:677-685.
Reference 113 Combining triptolide with ABT-199 is effective against acute myeloid leukemia through reciprocal regulation of Bcl-2 family proteins and activation of the intrinsic apoptotic pathway. Cell Death Dis. 2020 Jul 22;11(7):555.
Reference 114 Synergistic cytotoxicity and apoptosis induced in human cholangiocarcinoma cell lines by a combined treatment with tumor necrosis factor-alpha (TNF-alpha) and triptolide. Asian Pac J Allergy Immunol. 2002 Sep;20(3):167-73.
Reference 115 Fisetin Enhances Chemotherapeutic Effect of Cabazitaxel against Human Prostate Cancer Cells. Mol Cancer Ther. 2016 Dec;15(12):2863-2874.
Reference 116 Piperine (PP) enhanced mitomycin-C (MMC) therapy of human cervical cancer through suppressing Bcl-2 signaling pathway via inactivating STAT3/NF-KappaB. Biomed Pharmacother. 2017 Dec;96:1403-1410.
Reference 117 Methylglyoxal in combination with 5-Fluorouracil elicits improved chemosensitivity in breast cancer through apoptosis and cell cycle inhibition. Biomed Pharmacother. 2019 Jun;114:108855.
Reference 118 Synergistic anti-cancer action of salicylic acid and cisplatin on HeLa cells elucidated by network pharmacology and in vitro analysis. Life Sci. 2021 Oct 1;282:119802.
Reference 119 Osthole enhances TRAIL-mediated apoptosis through downregulation of c-FLIP expression in renal carcinoma Caki cells. Oncol Rep. 2017 Apr;37(4):2348-2354.
Reference 120 Sulforaphane sensitizes tumor necrosis factor-related apoptosis-inducing ligand (TRAIL)-resistant hepatoma cells to TRAIL-induced apoptosis through reactive oxygen species-mediated up-regulation of DR5. Cancer Res. 2006 Feb 1;66(3):1740-50.
Reference 121 Curcumin ameliorates oxaliplatin-induced chemoresistance in HCT116 colorectal cancer cells in vitro and in vivo. Int J Cancer. 2011 Jul 15;129(2):476-86.
Reference 122 Beta-elemene increases the sensitivity of gastric cancer cells to TRAIL by promoting the formation of DISC in lipid rafts. Cell Biol Int. 2018 Sep;42(10):1377-1385.
Reference 123 Sulforaphane potentiates the efficacy of imatinib against chronic leukemia cancer stem cells through enhanced abrogation of Wnt/Beta-catenin function. J Agric Food Chem. 2012 Jul 18;60(28):7031-9.
Reference 124 Sulforaphane enhances the cisplatin sensitivity through regulating DNA repair and accumulation of intracellular cisplatin in ovarian cancer cells. Exp Cell Res. 2020 Aug 15;393(2):112061.
Reference 125 Sulforaphane potentiates oxaliplatin-induced cell growth inhibition in colorectal cancer cells via induction of different modes of cell death. Cancer Chemother Pharmacol. 2011 May;67(5):1167-78.
Reference 126 Triptolide synergistically enhances temozolomide-induced apoptosis and potentiates inhibition of NF-KappaB signaling in glioma initiating cells. Am J Chin Med. 2014;42(2):485-503.
Reference 127 Synergistic anti-cancer activity by the combination of TRAIL/APO-2L and celastrol. Cancer Invest. 2010 Jan;28(1):23-32.
Reference 128 The synergic effect of vincristine and vorinostat in leukemia in vitro and in vivo. J Hematol Oncol. 2015 Jul 10;8:82.
Reference 129 Capsaicin enhances the antitumor activity of sorafenib in hepatocellular carcinoma cells and mouse xenograft tumors through increased ERK signaling. Acta Pharmacol Sin. 2018 Mar;39(3):438-448.
Reference 130 Phytosphingosine in combination with ionizing radiation enhances apoptotic cell death in radiation-resistant cancer cells through ROS-dependent and -independent AIF release. Blood. 2005 Feb 15;105(4):1724-33.
Reference 131 beta-1,2,3-Triazolyl-nucleosides as nicotinamide riboside mimics. Nucleosides Nucleotides Nucleic Acids. 2009 Mar;28(3):238-59.
Cite NPCDR
Visitor Map
Correspondence

X. N. Sun, Y. T. Zhang, Y. Zhou, X. C. Lian, L. L. Yan, T. Pan, T. Jin, H. Xie, Z. M. Liang, W. Q. Qiu, J. X. Wang, Z. R. Li, F. Zhu*, X. B. Sui*. NPCDR: natural product-based drug combination and its disease-specific molecular regulation. Nucleic Acids Research. 50(D1): 1324-1333 (2020). PMID: 34664659

Prof. Feng ZHU  (zhufeng@zju.edu.cn)

College of Pharmaceutical Sciences, Zhejiang University, Hangzhou, China


Prof. Xinbing SUI  (suilab@hznu.edu.cn)

School of Pharmacy and Department of Medical Oncology, the Affiliated Hospital of Hangzhou Normal University, Hangzhou Normal University, Hangzhou, China