Molecule Details
| General Information of the Molecule | ||||
|---|---|---|---|---|
| Name |
Apoptosis regulator Bcl-2 (BCL-2)
|
|||
| Synonyms |
Bcl-2
|
|||
| Gene Name |
BCL2
|
|||
| Gene ID | ||||
| Sequence |
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK Click to Show/Hide
|
|||
| Function |
Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release. Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
Click to Show/Hide
|
|||
| Uniprot ID | ||||
| TC Number | ||||
| Pfam | ||||
| KEGG ID | ||||
| TTD ID | ||||
| A List of Drug Combination(s) Able to Regulate This Molecule | ||||
|---|---|---|---|---|
| Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
| Down-regulation | Click to Show/Hide | |||
| Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Curcumin NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 2 Down-regulating the Expression of This Molecule | [2] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Osthole NP Info | + | Trastuzumab Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 3 Down-regulating the Expression of This Molecule | [3] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Wogonin NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 4 Down-regulating the Expression of This Molecule | [4] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Dicoumarol NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 5 Down-regulating the Expression of This Molecule | [5] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Pterostilbene NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 6 Down-regulating the Expression of This Molecule | [6] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Pterostilbene NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 7 Down-regulating the Expression of This Molecule | [7] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Quercetin NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 8 Down-regulating the Expression of This Molecule | [8] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Triptolide NP Info | + | Vasostatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 9 Down-regulating the Expression of This Molecule | ||||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Resveratrol NP Info | + | Doxorubicin Drug Info | |
| Drug Combination 10 Down-regulating the Expression of This Molecule | [9] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Resveratrol NP Info | + | Doxorubicin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 11 Down-regulating the Expression of This Molecule | [10] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Carnosic acid NP Info | + | Tamoxifen Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 12 Down-regulating the Expression of This Molecule | [11] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Triptolide NP Info | + | Gemcitabine Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 13 Down-regulating the Expression of This Molecule | [12] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Fisetin NP Info | + | Sorafenib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 14 Down-regulating the Expression of This Molecule | [13] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Shikonin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 15 Down-regulating the Expression of This Molecule | [14] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Paclitaxel NP Info | + | BMS-231974 Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 16 Down-regulating the Expression of This Molecule | [15] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Thymoquinone NP Info | + | Bortezomib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 17 Down-regulating the Expression of This Molecule | [16] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Sulforaphane NP Info | + | Gefitinib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 18 Down-regulating the Expression of This Molecule | [17] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | 6-shogaol NP Info | + | Gemcitabine Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 19 Down-regulating the Expression of This Molecule | [18] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | 6-shogaol NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 20 Down-regulating the Expression of This Molecule | [19] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Genistein NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 21 Down-regulating the Expression of This Molecule | [20] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Parthenolide NP Info | + | Epirubicin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 22 Down-regulating the Expression of This Molecule | [21] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Paeonol NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 23 Down-regulating the Expression of This Molecule | [22] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Epigallocatechin gallate NP Info | + | ONO-8711 Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 24 Down-regulating the Expression of This Molecule | [23] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Alpha solanine NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 25 Down-regulating the Expression of This Molecule | [24] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Chlorogenic acid NP Info | + | Methotrexate Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 26 Down-regulating the Expression of This Molecule | [25] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Apigenin NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 27 Down-regulating the Expression of This Molecule | [26] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Resveratrol NP Info | + | ABT-737 Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 28 Down-regulating the Expression of This Molecule | [27] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Triptolide NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 29 Down-regulating the Expression of This Molecule | [28] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Apigenin NP Info | + | Gefitinib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 30 Down-regulating the Expression of This Molecule | [29] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Gambogic acid NP Info | + | Doxorubicin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 31 Down-regulating the Expression of This Molecule | [30] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Gambogic acid NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 32 Down-regulating the Expression of This Molecule | [31] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Shikonin NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 33 Down-regulating the Expression of This Molecule | [32] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Curcumin NP Info | + | Mitomycin C Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 34 Down-regulating the Expression of This Molecule | [33] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Daidzein NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 35 Down-regulating the Expression of This Molecule | [34] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Resveratrol NP Info | + | Trastuzumab Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 36 Down-regulating the Expression of This Molecule | [35] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Cucurbitacin B NP Info | + | Doxorubicin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 37 Down-regulating the Expression of This Molecule | [36] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Allyl isothiocyanate NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 38 Down-regulating the Expression of This Molecule | [37] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Epigallocatechin gallate NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 39 Down-regulating the Expression of This Molecule | [38] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Piperlongumine NP Info | + | Oxaliplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 40 Down-regulating the Expression of This Molecule | [39] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Ceramide NP Info | + | N, N-dimethyl-D-erythro-sphingosine Drug Info | |
| Drug Combination 41 Down-regulating the Expression of This Molecule | [40] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Ursolic acid NP Info | + | Gemcitabine Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 42 Down-regulating the Expression of This Molecule | [41] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Methylglyoxal NP Info | + | Glyoxalase I Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 43 Down-regulating the Expression of This Molecule | [42] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Resveratrol NP Info | + | Raloxifene Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 44 Down-regulating the Expression of This Molecule | [43] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Curcumin NP Info | + | Capecitabine Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 45 Down-regulating the Expression of This Molecule | [44] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Epigallocatechin gallate NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 46 Down-regulating the Expression of This Molecule | [45] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Galangin NP Info | + | Imatinib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 47 Down-regulating the Expression of This Molecule | [46] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Demethoxycurcumin NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 48 Down-regulating the Expression of This Molecule | [47] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Rutin NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 49 Down-regulating the Expression of This Molecule | [48] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Arsenic trioxide NP Info | + | Itraconazole Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 50 Down-regulating the Expression of This Molecule | [49] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Eugenol NP Info | + | Gemcitabine Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 51 Down-regulating the Expression of This Molecule | [50] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Acteoside NP Info | + | Thymic stromal lymphopoietin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 52 Down-regulating the Expression of This Molecule | [51] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Arsenic trioxide NP Info | + | Bortezomib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 53 Down-regulating the Expression of This Molecule | [52] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Genistein NP Info | + | HA14-1 Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 54 Down-regulating the Expression of This Molecule | [53] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Cardamonin NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 55 Down-regulating the Expression of This Molecule | [54] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Curcumin NP Info | + | Letrozole Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 56 Down-regulating the Expression of This Molecule | [55] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Carnosic acid NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 57 Down-regulating the Expression of This Molecule | [56] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Tangeretin NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 58 Down-regulating the Expression of This Molecule | [57] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Apigenin NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 59 Down-regulating the Expression of This Molecule | [58] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Arsenic trioxide NP Info | + | 1,25-dihydroxyvitamin D3 Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 60 Down-regulating the Expression of This Molecule | [59] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Hesperetin NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 61 Down-regulating the Expression of This Molecule | [60] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Arsenic trioxide NP Info | + | Androgen Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 62 Down-regulating the Expression of This Molecule | [61] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Thymoquinone NP Info | + | Gemcitabine Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 63 Down-regulating the Expression of This Molecule | [62] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Triptolide NP Info | + | Aspirin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 64 Down-regulating the Expression of This Molecule | [63] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Arsenic trioxide NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 65 Down-regulating the Expression of This Molecule | [64] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Quercetin NP Info | + | 2-methoxyestradiol Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 66 Down-regulating the Expression of This Molecule | [65] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Gallic acid NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 67 Down-regulating the Expression of This Molecule | [66] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Piperine NP Info | + | Mitomycin C Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 68 Down-regulating the Expression of This Molecule | [67] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Ellagic acid NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 69 Down-regulating the Expression of This Molecule | [68] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Gossypol NP Info | + | Imatinib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 70 Down-regulating the Expression of This Molecule | [69] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Artesunate NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 71 Down-regulating the Expression of This Molecule | [70] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Silibinin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 72 Down-regulating the Expression of This Molecule | [71] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Flavopiridol NP Info | + | Gemcitabine Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 73 Down-regulating the Expression of This Molecule | [72] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Betulinic Acid NP Info | + | Sorafenib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 74 Down-regulating the Expression of This Molecule | [73] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Oroxylin A NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 75 Down-regulating the Expression of This Molecule | [74] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Gossypol NP Info | + | Doxorubicin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 76 Down-regulating the Expression of This Molecule | [75] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Elemene NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 77 Down-regulating the Expression of This Molecule | [76] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Gambogic acid NP Info | + | Sunitinib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 78 Down-regulating the Expression of This Molecule | [77] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Luteolin NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 79 Down-regulating the Expression of This Molecule | [78] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Curcumin NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 80 Down-regulating the Expression of This Molecule | [79] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Triptolide NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 81 Down-regulating the Expression of This Molecule | [80] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Eugenol NP Info | + | 2-methoxyestradiol Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 82 Down-regulating the Expression of This Molecule | [81] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Curcumin NP Info | + | Gemcitabine Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 83 Down-regulating the Expression of This Molecule | [82] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Resveratrol NP Info | + | Sorafenib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 84 Down-regulating the Expression of This Molecule | [83] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Resveratrol NP Info | + | Gemcitabine Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 85 Down-regulating the Expression of This Molecule | [84] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Noscapine NP Info | + | Doxorubicin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 86 Down-regulating the Expression of This Molecule | [85] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Epigallocatechin gallate NP Info | + | SU5416 Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 87 Down-regulating the Expression of This Molecule | [86] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Thymoquinone NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 88 Down-regulating the Expression of This Molecule | [87] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Arsenic trioxide NP Info | + | ABT-737 Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 89 Down-regulating the Expression of This Molecule | [88] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Paclitaxel NP Info | + | Coralyne Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 90 Down-regulating the Expression of This Molecule | [89] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Curcumin NP Info | + | Carboplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 91 Down-regulating the Expression of This Molecule | [90] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Honokiol NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 92 Down-regulating the Expression of This Molecule | [91] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Genistein NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 93 Down-regulating the Expression of This Molecule | [92] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Arsenic trioxide NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 94 Down-regulating the Expression of This Molecule | [93] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Noscapine NP Info | + | Gemcitabine Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 95 Down-regulating the Expression of This Molecule | [94] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Cordycepin NP Info | + | Apatinib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 96 Down-regulating the Expression of This Molecule | [95] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Apigenin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 97 Down-regulating the Expression of This Molecule | [96] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Resveratrol NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 98 Down-regulating the Expression of This Molecule | [97] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Shikonin NP Info | + | Gemcitabine Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 99 Down-regulating the Expression of This Molecule | [98] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Chrysin NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 100 Down-regulating the Expression of This Molecule | [99] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Curcumin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 101 Down-regulating the Expression of This Molecule | [100] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Arsenic trioxide NP Info | + | Valproic acid Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 102 Down-regulating the Expression of This Molecule | [101] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Ursolic acid NP Info | + | Capecitabine Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 103 Down-regulating the Expression of This Molecule | [102] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Gambogic acid NP Info | + | Gefitinib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 104 Down-regulating the Expression of This Molecule | [103] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Cinnamaldehyde NP Info | + | Doxorubicin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 105 Down-regulating the Expression of This Molecule | [104] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Bufalin NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 106 Down-regulating the Expression of This Molecule | [105] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Epigallocatechin gallate NP Info | + | Vorinostat Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 107 Down-regulating the Expression of This Molecule | [106] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Silibinin NP Info | + | Vorinostat Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 108 Down-regulating the Expression of This Molecule | [107] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Thymoquinone NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 109 Down-regulating the Expression of This Molecule | [108] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Osthole NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 110 Down-regulating the Expression of This Molecule | [109] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Sulforaphane NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 111 Down-regulating the Expression of This Molecule | [110] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Pterostilbene NP Info | + | Sorafenib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 112 Down-regulating the Expression of This Molecule | [111] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Celastrol NP Info | + | ABT-737 Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 113 Down-regulating the Expression of This Molecule | [112] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Bisdemethoxycurcumin NP Info | + | X-ray irradiation Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 114 Down-regulating the Expression of This Molecule | [113] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Emodin NP Info | + | Cytarabine Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 115 Down-regulating the Expression of This Molecule | [114] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Silibinin NP Info | + | Sorafenib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 116 Down-regulating the Expression of This Molecule | [115] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Curcumin NP Info | + | Oxaliplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 117 Down-regulating the Expression of This Molecule | [116] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Saikosaponin D NP Info | + | SP600125 Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 118 Down-regulating the Expression of This Molecule | [117] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Gossypol NP Info | + | Gemcitabine Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 119 Down-regulating the Expression of This Molecule | [118] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Sulforaphane NP Info | + | Imatinib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 120 Down-regulating the Expression of This Molecule | [119] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Apicidin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 121 Down-regulating the Expression of This Molecule | [120] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Galangin NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 122 Down-regulating the Expression of This Molecule | [121] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Gambogic acid NP Info | + | Imatinib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 123 Down-regulating the Expression of This Molecule | [122] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Betulinic Acid NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 124 Down-regulating the Expression of This Molecule | [123] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Clavulanate NP Info | + | Amoxicillin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 125 Down-regulating the Expression of This Molecule | [124] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Curdione NP Info | + | Doxorubicin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 126 Down-regulating the Expression of This Molecule | [125] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Gambogic acid NP Info | + | Gemcitabine Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 127 Down-regulating the Expression of This Molecule | [126] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Galangin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 128 Down-regulating the Expression of This Molecule | [127] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Cyanidin-3-O-glucoside chloride NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 129 Down-regulating the Expression of This Molecule | [128] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Gambogic acid NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 130 Down-regulating the Expression of This Molecule | [129] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Bufalin NP Info | + | Vorinostat Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 131 Down-regulating the Expression of This Molecule | [130] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Kaempferol NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 132 Down-regulating the Expression of This Molecule | [131] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Chlorogenic acid NP Info | + | Regorafenib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 133 Down-regulating the Expression of This Molecule | [132] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Resveratrol NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 134 Down-regulating the Expression of This Molecule | [133] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Sulforaphane NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 135 Down-regulating the Expression of This Molecule | [134] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Curcumin NP Info | + | Tamoxifen Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 136 Down-regulating the Expression of This Molecule | [135] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Piperine NP Info | + | Celecoxib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 137 Down-regulating the Expression of This Molecule | [136] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Epigallocatechin gallate NP Info | + | Erlotinib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 138 Down-regulating the Expression of This Molecule | [137] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Resveratrol NP Info | + | Temozolomide Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 139 Down-regulating the Expression of This Molecule | [138] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Arsenic trioxide NP Info | + | Sorafenib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 140 Down-regulating the Expression of This Molecule | [139] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Cryptoxanthin NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 141 Down-regulating the Expression of This Molecule | [140] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Arsenic trioxide NP Info | + | Gilteritinib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 142 Down-regulating the Expression of This Molecule | [141] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Tetrandrine NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 143 Down-regulating the Expression of This Molecule | [142] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Triptolide NP Info | + | Temozolomide Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 144 Down-regulating the Expression of This Molecule | [143] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Theaflavin-3,3'-digallate + Black tea polyphenol | + | Cisplatin | |
| Click to Show/Hide the Each NP or Drug Structure of This Combination | ||||
| Theaflavin-3,3'-digallate NP Info | Drug Info | |||
|
|
|||
| Black tea polyphenol NP Info | ||||
|
|
|||
| Drug Combination 145 Down-regulating the Expression of This Molecule | [144] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Quercetin NP Info | + | Doxorubicin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 146 Down-regulating the Expression of This Molecule | [145] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Metformin NP Info | + | Pemetrexed Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 147 Down-regulating the Expression of This Molecule | [146] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Gingerol NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 148 Down-regulating the Expression of This Molecule | [147] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Arsenic trioxide NP Info | + | Polyinosinic acid-polycytidylic acid Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 149 Down-regulating the Expression of This Molecule | [14] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Paclitaxel NP Info | + | BMS-228987 Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 150 Down-regulating the Expression of This Molecule | [148] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Daidzein NP Info | + | Topotecan Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 151 Down-regulating the Expression of This Molecule | [149] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Vincristine NP Info | + | Vorinostat Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 152 Down-regulating the Expression of This Molecule | ||||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Curcumin NP Info | + | doxorubicin Drug Info | |
| Drug Combination 153 Down-regulating the Expression of This Molecule | [1] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Curcumin NP Info | + | Doxorubicin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 154 Down-regulating the Expression of This Molecule | [150] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Capsaicin NP Info | + | Sorafenib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 155 Down-regulating the Expression of This Molecule | [151] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Licochalcone A NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 156 Down-regulating the Expression of This Molecule | [152] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Ursolic acid NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 157 Down-regulating the Expression of This Molecule | [153] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Plumbagin NP Info | + | Zoledronic Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 158 Down-regulating the Expression of This Molecule | [154] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Curcumin NP Info | + | Dactolisib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 159 Down-regulating the Expression of This Molecule | [106] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Silibinin NP Info | + | Trichostatin A Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 160 Down-regulating the Expression of This Molecule | [155] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Gambogic acid NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 161 Down-regulating the Expression of This Molecule | [156] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Borneol NP Info | + | Doxorubicin Drug Info | |
| Structure |
|
+ |
|
|
| Up-regulation | Click to Show/Hide | |||
| Drug Combination 1 Up-regulating the Expression of This Molecule | [12] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Fisetin NP Info | + | Sorafenib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 2 Up-regulating the Expression of This Molecule | [157] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Triptolide NP Info | + | Lcotinib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 3 Up-regulating the Expression of This Molecule | [158] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Bufalin NP Info | + | Doxorubicin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 4 Up-regulating the Expression of This Molecule | [159] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Alpha linolenic acid NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 5 Up-regulating the Expression of This Molecule | [160] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Thymoquinone NP Info | + | Topotecan Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 6 Up-regulating the Expression of This Molecule | [161] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Genistein NP Info | + | Trichostatin A Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 7 Up-regulating the Expression of This Molecule | [162] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Triptolide NP Info | + | Gefitinib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 8 Up-regulating the Expression of This Molecule | [163] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Paclitaxel NP Info | + | Bcl-2 siRNA Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 9 Up-regulating the Expression of This Molecule | [164] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Oridonin NP Info | + | Imatinib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 10 Up-regulating the Expression of This Molecule | [165] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Alpha linolenic acid NP Info | + | Gentamicin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 11 Up-regulating the Expression of This Molecule | [109] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Sulforaphane NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 12 Up-regulating the Expression of This Molecule | [166] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Noscapine NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 13 Up-regulating the Expression of This Molecule | [167] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Acteoside + Paeoniflorin | + | X-ray irradiation | |
| Click to Show/Hide the Each NP or Drug Structure of This Combination | ||||
| Acteoside NP Info | Drug Info | |||
|
|
|||
| Paeoniflorin NP Info | ||||
|
|
|||
| Drug Combination 14 Up-regulating the Expression of This Molecule | [168] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Alpha linolenic acid NP Info | + | Doxorubicin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 15 Up-regulating the Expression of This Molecule | [133] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Sulforaphane NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 16 Up-regulating the Expression of This Molecule | [169] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Pentagalloylglucose NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 17 Up-regulating the Expression of This Molecule | [170] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Daunorubicin NP Info | + | Bortezomib Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 18 Up-regulating the Expression of This Molecule | [157] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Triptolide NP Info | + | Erlotinib Drug Info | |
| Structure |
|
+ |
|
|
| Phosphorylation Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
| Up-regulation | Click to Show/Hide | |||
| Drug Combination 1 Up-regulating the Phosphorylation of This Molecule | [75] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Elemene NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Natural Product(s) of This Target | ||||
|---|---|---|---|---|
| 1 | Anatolian propolis extracts | NP Info | . | Not Available |
| 2 | Cucurbitacin D | NP Info | Investigative | Cucurbitaceae |
| 3 | Gossypol | NP Info | Phase 2 | Gossypium herbaceum |
| 4 | Marein | NP Info | . | Not Available |
| 5 | Matrine | NP Info | Investigative | Sophora viciifolia |
| 6 | Oroxylin A | NP Info | Investigative | Oroxylum indicum |
| 7 | Paclitaxel | NP Info | Approved | Taxus brevifolia |
| 8 | Pentagalloyl glucose (PGG) | NP Info | Rhus chinensis | |
| 9 | Tanshinone IIA | NP Info | Phase 4 | Salvia miltiorrhiza |
| 10 | Withaferin A | NP Info | Terminated | Withania somnifera |
| 11 | Xanthohumol | NP Info | Investigative | Humulus lupulus |
| Drug(s) of This Target | ||||
|---|---|---|---|---|
| 1 | ABT-263 | Drug Info | Phase 2 | Chronic lymphocytic leukaemia |
| 2 | ABT-737 | Drug Info | Phase 1 | Ovarian cancer |
| 3 | Adriamycin | Drug Info | . | Not Available |
| 4 | Alpha PD-L1 antibody | Drug Info | Investigative | Osteosarcoma |
| 5 | Chidamide | Drug Info | . | Not Available |
| 6 | Cisplatin | Drug Info | Approved | Bladder cancer |
| 7 | Cisplatin | Drug Info | Approved | Bladder cancer |
| 8 | Edaravone | Drug Info | Approved | Motor neuron disease |
| 9 | MEK inhibitors | Drug Info | . | Not Available |
| 10 | MG262 | Drug Info | Investigative | Ovarian cancer |
| 11 | Sorafenib | Drug Info | Approved | Renal cell carcinoma |
| 12 | VE-465 | Drug Info | Investigative | Hepatocellular carcinoma |
| 13 | Venetoclax | Drug Info | Approved | Chronic lymphocytic leukaemia |